SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|235673|estExt_fgenesh2_pg.C_sca_680005 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|235673|estExt_fgenesh2_pg.C_sca_680005
Domain Number 1 Region: 30-73
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000539
Family EGF-type module 0.04
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|235673|estExt_fgenesh2_pg.C_sca_680005
Domain Number - Region: 103-172
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000591
Family Fibronectin type III 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|235673|estExt_fgenesh2_pg.C_sca_680005
Sequence length 315
Sequence
MLFLAILIIIGMVLAIGSANSQELQKVLHTSCDELNCENDNPCQSVTNDGPTQATCFCQG
PWTGSRCELAIIFITKSVTDDSVELEVKGRNSKNISKILQYHQKYTIRYWSNSTEHACML
VQDVASPTHVIDGLSQSVQYTFCAETGIVDFCEVRSFGSGLPSNCVSVLTLNAYDQSESS
EFFNVGVSLIVVFSVLIFITIVVIVLVKKYQPLTFNVLLRLCFCCSIQSQHEFSSHNDQS
SVFTSTDTPIYKRSKRKGLSSSKSKTKSRLAKRAKDYGAEGGNQTLTTLIEDTEDPVVIE
TSLVEVEPLAQQHIV
Download sequence
Identical sequences V3ZTL8
jgi|Lotgi1|235673|estExt_fgenesh2_pg.C_sca_680005 XP_009063375.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]