SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|235911|estExt_fgenesh2_pg.C_sca_710107 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|235911|estExt_fgenesh2_pg.C_sca_710107
Domain Number 1 Region: 759-875
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000518
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 840-955
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000596
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 532-685
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000188
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 4 Region: 150-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000729
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 5 Region: 688-800
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000345
Family Growth factor receptor domain 0.007
Further Details:      
 
Domain Number 6 Region: 448-495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000614
Family EGF-type module 0.022
Further Details:      
 
Domain Number 7 Region: 483-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000399
Family EGF-type module 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|235911|estExt_fgenesh2_pg.C_sca_710107
Sequence length 1218
Sequence
MNSVLLVAVYFLLDLKFSEGNLDDLLIPCCNEGLDWSLGDNRCSSHHGYVANISREDLPT
CHSVIELCCIKDVFVKQCEKGKENALDGQMCAIRDSEEGAEKYKECCICCELGLIAKSQG
LSCQTPDYGSPCDNMFHECCTGQKYYDVFNSTADDRNECALFPGQICSHTCVNTVGSFRC
ECRDGYSLNVDGRTCQQSDGEYGDTDYNCYYCYLGEYGDTDYNCYYCYLGEYGDTDYNCY
YCYLGEYGEYGDTDYNCYYCYLGEYGDIDYNCYYCYLGEYVDTDYNCYYCYLGEYGDKAY
NCYLGEDGDTDYNCYYCYLGEYGDTDYNCYYCYLGEYGDTDYNCYLCEYSDTDYNCYYCY
LGEYVDIDYNCYYCYLGEYGDTDYNCYYCCLGEYVDADYNCYYCYLGEYGDIDYNCYYCH
LGEYGDIDYNCYYCCLGEYVDADYNCEDNNPCEHRCFALDDENVQCSCYEGFTINNDGRT
CTDIDECADGTYQCAPTQECVNTPGRYTCHTAQCEPGLVFNPITRICEDSFECERGFGFN
SVTRQCEDINECTIYDDLCTGQYEICHNLNASYICECEEGFERDRITRQCQDLNECGLGI
DTCLVGERCDNTIGSYSCRRFRHCGTGYTLDEQSQRCKDDDECILGTHNCGRGYQCVNVQ
GSFRCEVKRCEEGTRFNPVNGECERVNCKRGLRPDRIGNCIDINECIEYSTICNQYQQCV
NTIGSYQCRSLVNCPNGFETNENGRCVDIDECASGKHRCAGEQQCVNRQGSYFCQCPRGY
RFINNICEDVDECAYSAAICPLQSKCQNTPGSYVCTCKDGLESDGRGGCSDIDECTTRNI
CHHKCINNFGSYFCTCNRGYQLSVDQRTCEDIDECNQFGGRGRVCGGRCSNTPGSFTCDC
PDGWKKSRDSRSCEDIDECSDGTAFCPSRDSTCVNTRGGYKCPVVQCPEGFVKTVPGGQQ
NAVRCKQAGSFNPNANELISMSYNFLTFPTNIIIPTPLFSMTGAKDSQRRYSWELKILQA
RPLLAGVPRASKLNFELSQTNNQAVVTLVKRIQGPQDVILQLLMKIQSEKFNGIAESKIY
LELIADEGGVVCGRISCDPLDLRCVSNKTKTISWQYLALPSMDFVKIPVTLLNIKTIGYS
IYPNLDLRIVAGNRDRFFDTVVEGDKAALRLLRPLPGPRERQVTLQLENRDFSRRNVISR
HVTHVKMFVSEYNANHMF
Download sequence
Identical sequences V3ZWA7
XP_009064154.1.39240 jgi|Lotgi1|235911|estExt_fgenesh2_pg.C_sca_710107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]