SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|236385|estExt_fgenesh2_pg.C_sca_800046 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|236385|estExt_fgenesh2_pg.C_sca_800046
Domain Number 1 Region: 350-393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000148
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 2 Region: 143-277
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000235
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 388-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000012
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 4 Region: 425-464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000493
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 29-69
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000712
Family EGF-type module 0.019
Further Details:      
 
Domain Number 6 Region: 73-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000774
Family EGF-type module 0.017
Further Details:      
 
Domain Number 7 Region: 272-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000559
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|236385|estExt_fgenesh2_pg.C_sca_800046
Domain Number - Region: 466-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000227
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 311-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00249
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|236385|estExt_fgenesh2_pg.C_sca_800046
Sequence length 584
Sequence
METKAYLHPTIIVIITLSYYLLLPLPVRCQTEVNFCTNDTCDNNGSCYEVENDFGCNCSE
GWTGKTCNILKNSNCSDGPCKNSGQCTPQTPTGGGQSFNCSCMDGYQGSTCEVVVDNCVD
IPCQNGGNCSVDLTKPDFITCSCPDGFDGLKCENNKNDCLSGVCNNNGICEDLVNDYYCN
CTEGWKGRNCEVNIDECNETLPCQHGTCTDTPGSYICNCIGTGYNGSNCADEVDECNLPV
PPCQNGASCTNTEGSYECNCTIGYDGTDCNEPSCDDNQCINNSTCTITNNNKWKCNCMQF
YYGKFCETPGPCTNNYCSASNTNYCSQNEADFTYTCHCKQGWQGENCTEDVNECDSIPCK
NGGTCNNTVGSYICDCALGYTGTNCTINIDDCQNKCQNNGTCTDLVNDFKCHCPDAYSGK
TCEVDVNECDNDIQICQNNQSCENTVGSYICKCTQQYLGKNCEYNNPCMNLKCENGGECN
KTYVGDTDRYEGLCDCVTGYEGVLCEKAGPSIDPVDDSIDIWVIIGPIIAIIIIIVIIGV
VIFLITARNKRATRGQYCPSQQETAGARVELGNVLKRPPAERLI
Download sequence
Identical sequences V3ZSM0
XP_009065452.1.39240 jgi|Lotgi1|236385|estExt_fgenesh2_pg.C_sca_800046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]