SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|237075|estExt_fgenesh2_pg.C_sca_940029 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|237075|estExt_fgenesh2_pg.C_sca_940029
Domain Number 1 Region: 130-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000772
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 2 Region: 225-263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000707
Family LDL receptor-like module 0.0044
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|237075|estExt_fgenesh2_pg.C_sca_940029
Domain Number - Region: 45-119
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000753
Family Spermadhesin, CUB domain 0.023
Further Details:      
 
Domain Number - Region: 168-217
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0497
Family LDL receptor-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|237075|estExt_fgenesh2_pg.C_sca_940029
Sequence length 394
Sequence
MVSTLQSYPYPLNPLTSLHPVWDEIIVLIWMICNQLISKESGEGYLLDVSVNYEPYTPDD
LDCSLDYIHVGNDGNNIDLEKMTSYKYCKTLYRENVVSRYNYLWIVVSTSREPARLQFEV
TARPKVECNSTMEFECSPTQCIPTSAVCDGTADCYNGRDEFCMKQYEDNSCFYCFDGTCI
NPVLPRYHDNWGKELWYLCDEYQHCHDGTDERKDICYRVDSRVASMMYCEPSKNSTGQSV
LMWNTLQCDGIQHCRDGSDESKERCSDGNEKESIYKPVSIIIIICFLIFSIIGTLVALKV
YKRQQRKRINSELNQIETTHLHSESDTLTQKVCSIAQTTDPDHCESISEDSLSLTSSNPG
TLKSYQDVKLEWVEHQDDGTVEYIDDNGVRYTDL
Download sequence
Identical sequences V3ZDX3
jgi|Lotgi1|237075|estExt_fgenesh2_pg.C_sca_940029 XP_009067050.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]