SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|238278|estExt_fgenesh2_pg.C_sca_1390008 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|238278|estExt_fgenesh2_pg.C_sca_1390008
Domain Number 1 Region: 314-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000017
Family EGF-type module 0.018
Further Details:      
 
Domain Number 2 Region: 575-613
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000524
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 3 Region: 464-502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000559
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 4 Region: 1238-1274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000796
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 392-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000123
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 6 Region: 236-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000125
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 614-649
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 429-464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000258
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 161-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000028
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 200-240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000309
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 540-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000344
Family EGF-type module 0.009
Further Details:      
 
Domain Number 12 Region: 356-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000366
Family EGF-type module 0.011
Further Details:      
 
Domain Number 13 Region: 503-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family EGF-type module 0.014
Further Details:      
 
Domain Number 14 Region: 1356-1392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000103
Family EGF-type module 0.011
Further Details:      
 
Domain Number 15 Region: 729-768
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000028
Family EGF-type module 0.012
Further Details:      
 
Domain Number 16 Region: 1393-1429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000331
Family EGF-type module 0.012
Further Details:      
 
Domain Number 17 Region: 689-732
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000387
Family EGF-type module 0.019
Further Details:      
 
Domain Number 18 Region: 1119-1158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000404
Family EGF-type module 0.025
Further Details:      
 
Domain Number 19 Region: 76-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000519
Family EGF-type module 0.01
Further Details:      
 
Domain Number 20 Region: 1006-1044
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000581
Family EGF-type module 0.011
Further Details:      
 
Domain Number 21 Region: 968-1004
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000599
Family EGF-type module 0.012
Further Details:      
 
Domain Number 22 Region: 649-688
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000149
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 23 Region: 40-83
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000168
Family EGF-type module 0.031
Further Details:      
 
Domain Number 24 Region: 852-888
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000174
Family EGF-type module 0.012
Further Details:      
 
Domain Number 25 Region: 123-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000207
Family EGF-type module 0.033
Further Details:      
 
Domain Number 26 Region: 891-929
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000366
Family EGF-type module 0.011
Further Details:      
 
Domain Number 27 Region: 1160-1203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000602
Family EGF-type module 0.017
Further Details:      
 
Domain Number 28 Region: 770-810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.024
Further Details:      
 
Domain Number 29 Region: 1279-1314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000012
Family EGF-type module 0.02
Further Details:      
 
Domain Number 30 Region: 277-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000167
Family EGF-type module 0.011
Further Details:      
 
Domain Number 31 Region: 1315-1353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000796
Family EGF-type module 0.028
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|238278|estExt_fgenesh2_pg.C_sca_1390008
Domain Number - Region: 810-852
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000185
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 928-968
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000258
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 1196-1236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000384
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 1044-1087
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00099
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 1085-1118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00106
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|238278|estExt_fgenesh2_pg.C_sca_1390008
Sequence length 1507
Sequence
MKPNSKFLPVRPFMLPVFPVPLDIVSAWSTTALEQTSLREDPCFLNDCAAGSTCTFSPLV
TGFTCVCPNGFTGTLCNQAVKQCTSSTCLNGGTCISSGLSFFCQCPFGISGTRCENNNNI
CNNNPCENSGSCSANTLNVNGFTCTCAAGFTGTTCNTSPNNACSVNPCLNNGECVVSGTS
FICRCPTGFSGPTCQISDTVCNPSPCQNGGNCFPNGNSYFCQCPAGYSGINCQTVTNQCN
TLPCKNGATCFPNGNSYFCQCPVGFSGTNCDVVINQACNSGPCRNQGQCFNLNNGDFFCQ
CATGFTGLTCDTVISSCTSLPCQNGGACFPSGDSYLCQCPTGFTGVNCQTRIVNTPCNPS
PCQNGGTCFPSGTSYFCQCLAGFSGNECQTRSSCSPSPCQNGGTCFPSGTSYFCQCLAGF
SGNECQTRSSCSPSPCQNGGTCFPSGSSYFCQCQAGFTGNECQNVLPCSTNPCQNGGTCS
PSGTSYACQCPSGFSGTNCEIRSPCNPSPCQNGATCFPSGTSYFCQCLAGFSGNECQTRS
SCSPSPCQNGGTCFPSGSSYFCQCQAGFTGNECQNVLPCSTNPCQNGGTCSPSGTSYACQ
CPTGFSGTNCEIRSPCNPSPCQNGATCFPSGSSYFCRCPAGFSGDNCEVSPCDRNPCLYQ
GQCTANINLIGGYACSCRNGYTGTNCEVTPCSVTRCQNGGTCLLDSTLLAGYRCNCPSAY
TGTRCETSTNPCSVNPCANGGTCQPTGTTTTSFICQCNNNYIGDRCQTLSPCITNQCLNN
GQCIVDSSGTFTGGFRCACVNGYSGNNCQTSPCSSSQCVSGQGQCVLDTTRLGGFRCDCF
AGYSGDICQIRADPCVNNPCGFRGNCIASGSTYQCQCNAQYTGTNCETLLRCSFSPCLNN
GDCTELPSSQQGYRCSCRNGYSGENCQTSPCFSSQCVSGNCVEDVTRLTGFRCDCFAGFS
GDLCNVRADPCVNNPCGFGGNCIASGSTYQCQCNAQYTGTNCETLLRCSFSPCLNNGDCT
ELPSSQQGYRCSCRNGYSGENCQTSPCFSSQCVSGNCVEDVTRLTGFRCDCFTGFSGDLC
NVQSNRCQGVNCLNNGFCNPDTAQCVCQAGFTGTFCQNNSDPCEPDNCENGGKCIVISAN
TSICECPTGFSGELCQTVDNSDPCSAINCQNGGKCIKLTDILAICECPGGFRGEFCQNSP
NACNGVNCQNGGNCQVVGSTFRCNCPVTHTGNFCETPNNQCLNNPCQNGGTCAQGTNGFT
CTCPPFYSGNICQTVSPCLTGNPCANGRCVPETASSLFSCECFSGWSGSFCSVAVSPCTD
VNCNNGVCRQTSPTSSVCDCFPNYTGDRCDILLVSSPCTINPCQNGGVCSTTIGNNFSCS
CPSDFFGTRCETSDPCGSSPCKNGGLCSSSDLSFNCTCPEGYAGRICENQQPCPAYPCPD
TVSSFRYPDWNSLNCQGYYRCTDGSLVREFCSGATSAFDPFTMECEEQSQDNLCLAYQLQ
QQLGLPT
Download sequence
Identical sequences V4B202
XP_009047805.1.39240 jgi|Lotgi1|238278|estExt_fgenesh2_pg.C_sca_1390008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]