SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|238609|estExt_fgenesh2_pg.C_sca_1540027 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|238609|estExt_fgenesh2_pg.C_sca_1540027
Domain Number 1 Region: 474-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000401
Family EGF-type module 0.005
Further Details:      
 
Domain Number 2 Region: 234-362
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000267
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 3 Region: 396-439
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000518
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 4 Region: 358-401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000435
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 5 Region: 435-478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000768
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 6 Region: 512-553
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000304
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 759-799
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000084
Family EGF-type module 0.016
Further Details:      
 
Domain Number 8 Region: 792-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000132
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 9 Region: 910-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000219
Family EGF-type module 0.024
Further Details:      
 
Domain Number 10 Region: 871-913
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000879
Family EGF-type module 0.018
Further Details:      
 
Domain Number 11 Region: 584-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000103
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 12 Region: 829-872
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000232
Family EGF-type module 0.02
Further Details:      
 
Domain Number 13 Region: 689-725
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000214
Family EGF-type module 0.01
Further Details:      
 
Domain Number 14 Region: 654-690
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000025
Family EGF-type module 0.01
Further Details:      
 
Domain Number 15 Region: 549-585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000357
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 16 Region: 619-655
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000518
Family EGF-type module 0.011
Further Details:      
 
Domain Number 17 Region: 724-760
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000679
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|238609|estExt_fgenesh2_pg.C_sca_1540027
Sequence length 1178
Sequence
MVAPLFYSFLVLGLLFLSIPAVTPKGVIKVQLRTFKNPGGKGNNGHCCDGRWIFCGSACD
HRFEICLDKVNGDHRITSCQYGKITTKDVPDRNYIYFGSSIGGVRNPMVFTLNSIPSSIR
VKIGVWDVDDSSSHDYVGYLYKNINLTPGKSEYIMLSNRIVLTGNVWSACLPDYYGSDCS
VYCKASSNMWGFYTCDKTTGAKKCLAGFVEILKPFYLEEKIQNGCELRLFVLFPGYTGRN
CAVRTNECQSNPCRNGGTCLDGHLNYSCKCLKGFTGAQCEVNIDECASSPCLHGGLCVDS
VANYTCQCTKGWTGTNCQLDINECSSSPCQNNGVCRNEVAEYRCECQEGFTGGQCETNIN
ECENSPCRHSGTCIDLINGYTCICSQGMKGDNCEINIDDCEVNPCHNRAICLDLIADYFC
ACPTGFTGKECQTNINDCEYYSQPCQNGGSCIDGIDDYACQCLPGYEGYNCAIDVDECLS
SPCKNNGSCLDGINEYSCTCSLGYTGRDCEVDIDDCKDNSCVNNGTCVDAPASFSCLCDT
GFTGEYCEMDYCEYADCGNGTCVRQVDGYNCSCDPGITGVSCETDLCADSPCGNGTCVRS
LNGYNCSCDLGFSGTACEIDHCEGATCGNGTCVRQSDGYNCSCGLGFSGTACEIDHCEGA
TCGNGTCVRQSDGYNCSCELGFSGTACEIDHCEGATCGNGTCVRQSDEYNCSCDLGFSGT
ACEIDHCEVATCGNGMCIRQSDGYNCSCDYGFVGISCETDLCLDSPCGNGTCVPLSNDYT
CSCDVGFTGQRCDINIDDCEANLCQNSASCTDGVDSFICECLVGFTGQYCESEIDHCQFN
NCADGSSCVNSQESYSCICAEGTTGKSCEQNIDSCDPDPCTNNSTCVDQLTGFVCLCQSY
STGLLCDTLISPCEDSPCINNGTCVEEDVSNFTCSCTDEWTGPTCNERIIEVAFTTDTSG
LETSSPVPSTTSPTNAPFSTGSDDLPDATGRQLIKPMASYLNWFDRGEFVFSKKAKLANF
NICLWYQNPFSHSQWGLPPYEWGLVSVGGLVVVSVVGQVGGYLWIGRLCCRSGCSIAVFT
IELIHHGWIPFLFSVSSIVARLQLRTTWLDMVCNLGFWRCIQIELHYIRIKCLWCGMEAP
RIRKGESSDNLPTHYSTATIGVFWGHGLYDPTDPPIHR
Download sequence
Identical sequences V4ASU3
jgi|Lotgi1|238609|estExt_fgenesh2_pg.C_sca_1540027 XP_009049008.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]