SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|239217|estExt_fgenesh2_pg.C_sca_2070015 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|239217|estExt_fgenesh2_pg.C_sca_2070015
Domain Number 1 Region: 30-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000153
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|239217|estExt_fgenesh2_pg.C_sca_2070015
Sequence length 114
Sequence
MNFKSGLLVAAAVIVMANGQVVPGVCDTVICINGFCSVNALNQAVCQCEPGYKPSGTPQI
CVDIDECVEYDTLCNNQAGCCNFLGTYACLPCSAFTNKQARIPNSLLRRISDRK
Download sequence
Identical sequences V4AQI3
jgi|Lotgi1|239217|estExt_fgenesh2_pg.C_sca_2070015 XP_009052239.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]