SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|51876|gw1.29.3.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|51876|gw1.29.3.1
Domain Number 1 Region: 476-746
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-77
Family Protein kinases, catalytic subunit 0.0000265
Further Details:      
 
Domain Number 2 Region: 316-433
Classification Level Classification E-value
Superfamily PH domain-like 3.31e-23
Family Pleckstrin-homology domain (PH domain) 0.00013
Further Details:      
 
Domain Number 3 Region: 159-224
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.22e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0022
Further Details:      
 
Domain Number 4 Region: 45-115
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.49e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|51876|gw1.29.3.1
Sequence length 769
Sequence
LFFQFPEHGFYNLVDKILLFRHDSKSDNILQLIKSASDVTDGCLIDVILSEAATMEDLQI
RPHLMFVHSYKSPHFCDFCGELLFGLVKQGLKCDGCGLNFHKRCAYKIPNNCSNNRYRRQ
SSGSVSSLPFTLPREIKPFYPENAVRGPGSRTNSWSGRPVWIEREYQKRIKVPHTFIVHN
YTRPTVCHQCKKLLRGLFRQGMQCKDCKFNCHKRCMPIVPNDCAGEFINYSSPDQSLTTI
DTDITDNPTDNDDASITDLDPSADDNDDVVPKPPLRYGQHFEFFFLFSSPTQSSNIPLMR
VVQSVKLTKRTGSKILKEGWMVHFTNKENNRKRRYWRLDSKSITLYANETTTRYSKEILL
NTITGVEAIKIKPGTEFTRPPHVFEIRTTTLTYYVGEDIGYGQNNTNIVSSLESGSGYEQ
SKHWEQAIRQALMPVTTSNNSTEVPTNGEVESDTSKQIIFYVIYQADISTLYQIFPDDVL
GSGQFGIVYGGKHRKTNREVAIKVIDKMRFPTKHEAQLKTEVAILQNLSHPGSVNLEQMF
ETPERIFVVMEKLKGDMLEMILSSPKGRLSERITKYLISQILMALKHLHSKSIVHCDLKP
ENVLLTTETAFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLKRKGYNRSLDMWSV
GVVIYVSLSGTFPFNEDEEISDQIQNAAFMYPPNPWKEISQEAIDLITNLLQVKMRKRFT
VDKSLSHVFLQDYQCWCDLRILETNVGTRFLTHESDDERWETYRKEKNL
Download sequence
Identical sequences V4BYH1
jgi|Lotgi1|51876|gw1.29.3.1 XP_009054958.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]