SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|62520|gw1.143.24.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|62520|gw1.143.24.1
Domain Number 1 Region: 74-111
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 2 Region: 109-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000969
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 30-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 160-189
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0036
Further Details:      
 
Domain Number 5 Region: 2-28
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000038
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|62520|gw1.143.24.1
Sequence length 189
Sequence
TGGHYISTVYVCDGTEDCQDGSDEQDCVYSNCNNNTWRCHSGQCISIDRRCDLIPDCLDQ
SDEQGCGKKPSRDPRCPDSMFTCNNKQCINMLFYCDFTPHCSDSSDEISCVYSNCNNNTW
RCHSGQCISIDRRCDLIPDCLDQSDEQGCGKKPSRGCESGYYIKCRGSYCIPVNQVCDGR
PDCPEQDDE
Download sequence
Identical sequences V4B152
jgi|Lotgi1|62520|gw1.143.24.1 XP_009048301.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]