SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|70871|gw1.7329.3.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|70871|gw1.7329.3.1
Domain Number 1 Region: 112-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000991
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 2 Region: 33-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000242
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|70871|gw1.7329.3.1
Domain Number - Region: 3-39
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000245
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 74-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00837
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|70871|gw1.7329.3.1
Sequence length 156
Sequence
SESCDSNHVCHVDRDVVTCKCKTGYRGLQCSEDINECTDLSIDCNTGQCINTPGSFSCQC
QNDFTGGCQNGPVPCDKNNCNPLNTANCINTGTTTSRCECKPGFKGATCGESIDSCDSNP
CIHSQRCDNLVNDYTCICEAGWTGRRCETLIDTCSS
Download sequence
Identical sequences V3ZKV5
jgi|Lotgi1|70871|gw1.7329.3.1 XP_009064415.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]