SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|71205|gw1.30.148.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|71205|gw1.30.148.1
Domain Number 1 Region: 393-518
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000345
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 739-866
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000487
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 367-405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000017
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 4 Region: 332-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000172
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 5 Region: 676-718
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000114
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 6 Region: 529-568
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000069
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 294-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000185
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 602-650
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000594
Family EGF-type module 0.037
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|71205|gw1.30.148.1
Domain Number - Region: 720-748
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0358
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|71205|gw1.30.148.1
Sequence length 1147
Sequence
IWRRNFIKNMFPLHFCIFLVIVNLCNGSGYFHLQVNSVSNPRGEIADGSCCNGGRHDYRG
TCSEKCNTFFRVCLKEYQERVTTTGTCTFGNQSTVALGGNSFTYRSGNSRAMLKLPFEFA
WTRSYTLMVEAWDHSTNNGMDSLIERAAQTGMILPGQDWHTIIHTGPTASLVYKIQVVCD
EHYYNTTCTKFCRPHNDRFGHYTCDSNGDKVCLHGWMGQECETAICRTGCHAVHGSCERP
GDCRCAFGWKGLMCDECIPYPGCSHGSCNGSPWQCVCDLNWGGILCDKDLNFCGRHHPCK
NGGICRNTKPNEYQCSCSEGFSGKSCEIAERACSSSPCRHNGMCVDIVSGFACNCQPGWT
GRACETNINECESNPCLHNGTCLDKENRYICLCPSGWQGPHCQLDANECSGSPCVNAYAC
QDLRGDYHCDCQPGWTGKKCDINIDDCKDVECQHGASCVDLVSGYYCSCLPGYTGSLCEI
EIDECSSNPCKNGATCHNQLASYQCECLAGYTGYNCQVSSLKNYLYPLQVDIDPCNPNPC
QHGSSCFNIQGDFYCHCQHGFEGKDCSRRKTTCDSDTCEVIDSCTISIPSNFSNGGFRLI
SSNVCGKHGLCISEPSQGFSCACESGYTGTYCHENIDDCMSNPCLKGALCNISKYNHLFC
TAWYRFDIKVTFYSSDKDDCYPNPCRNGGQCIDLPAQFLCQCRNGWKGKTCTLRNSNCEV
TTCANGGTCVDLGDTYTCRCPSGWTGNMCQLASIHSCDSSPCENDGTCVNSGDSYTCICK
EGYEGNNCHININDCNPFPCYNGGRCIDGINWYVCDCATGFSGPDCRVNINECASNPCTY
GSTCLDGIGDYRCICPPGRTGHRCQTVIGQLPAPKSCLHQRRIYQDSTTWEHECNSCVCK
NGKVSCSKLWCGPRNCLPHPNNSEPVFTCQPEQTCVLQSEETCFTPPCIPWGHCKTLETI
KDLTPQGVQTKCIPNVEYLSNNCAKLTLIFDKAKMPTGVSIESICSTIRQLSIVKKLSNQ
NQMYILCGIKVNHLDAVEVTLSTVDDSRSRSYTSPSLKTAIDNVADIISHKQSNSSALAA
VIEIRVETTVVSKASSGFIIPLVCSIIILLGIVSIILLIWWHYKRKKKLRLRRDSYLTDN
RTNNETE
Download sequence
Identical sequences V4AJ71
jgi|Lotgi1|71205|gw1.30.148.1 XP_009055674.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]