SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|81536|gw1.81.136.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|81536|gw1.81.136.1
Domain Number 1 Region: 37-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000373
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 2 Region: 1-35
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000559
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 3 Region: 263-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000219
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 4 Region: 122-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000373
Family EGF-type module 0.023
Further Details:      
 
Domain Number 5 Region: 80-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000177
Family EGF-type module 0.011
Further Details:      
 
Domain Number 6 Region: 307-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000021
Family EGF-type module 0.0097
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|81536|gw1.81.136.1
Domain Number - Region: 198-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00176
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 161-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0021
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 231-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00839
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|81536|gw1.81.136.1
Sequence length 379
Sequence
CESNPCQNGGLCREENNGYNCICQGGFVGKNCENKPGNRCFYNPCMNAGSCIDLTTDYQC
ICPQPYYGKMCEFNKNFEPNNCLTKGCWNGGSCMNSGYCQCTDEFYGAQCEHQVYNTSTS
SPVSMCNGGYCQNGASCWSSSNTEYCYCLQGYTGKYCENKIVWCNGGYCKNGGSCIGGSY
CSCYGMYSGKYCEDYIWCNGGYCKNGGSCIGGSYCSCAGPYTGQYCDYYSKWCNGGYCKN
GGSCIGGSYCSCTGPYIGQYCDDFSTCESSPCQNGGSCQDYYYGIASYYTCNCPPGYYGK
RCEGRRLPCDSYPCQNGASCQDLTNETYSCSCPSSWGKNCERPAHDNCTVSILKNQSHLN
SSKKILICECSKGYSGLFC
Download sequence
Identical sequences V3ZHR4
XP_009065500.1.39240 jgi|Lotgi1|81536|gw1.81.136.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]