SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|96390|gw1.164.24.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|96390|gw1.164.24.1
Domain Number 1 Region: 1-44
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000447
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|96390|gw1.164.24.1
Domain Number - Region: 109-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0002
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 35-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000232
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 80-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000503
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|96390|gw1.164.24.1
Sequence length 136
Sequence
PCLNGGSCQPKSESFDDYYSCKCTDGWVGSRCQDDYDECTSSPCSWPYVCYNYENRYECA
CSQDEPDCDGLVASDAAYTCENYRRAESFDDYYSCKCTDGWVGSRCQDDYDECTSSPCSW
PYVCYNYENRYECACS
Download sequence
Identical sequences V4AXE5
jgi|Lotgi1|96390|gw1.164.24.1 XP_009049572.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]