SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|164657522|ref|XP_001729887.1| from Malassezia globosa CBS 7966

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|164657522|ref|XP_001729887.1|
Domain Number 1 Region: 743-894,1087-1256
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.05e-33
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.018
Further Details:      
 
Domain Number 2 Region: 294-351,407-556
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.15e-21
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.012
Further Details:      
 
Domain Number 3 Region: 47-170
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.44e-16
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|164657522|ref|XP_001729887.1|
Sequence length 1543
Comment hypothetical protein MGL_2873 [Malassezia globosa CBS 7966]
Sequence
MWWRCVHVYIGLFLGLSALLVRAAQSPSVNVSTFPNIPAQIKYFEDSSVVLWHDSIDGIV
YRSADEGMTWAPVSGPPMGHAYMLILHPYEPSQAFILSNGNDHWRSVNRGESWQRFSTPD
PPSLSGVSPLDFHADPQHKDWILYIGRRCSAWFFRTVCQDAAYYTTDGFASDAKLLLDLV
DQCHWAKMTPEVAVAPQAMQRILCIAWDESAKVPPLAHRTGLDAGSGAIPSTVGRAVPPA
ARASSWMTGMEKRDVRQSRLFMSDDLFNTRIPVSLEGRLEPRGFLNMGKSGEFLVAALSD
AQSSTPGELRLYVSRDAERWTQAQFPHAPLAHETGYTILEGPQHRLLVDMLDQTSRTSAL
FMSDSTGTNFSSSIVHTQRNADGIIDYEHLTNMEGAAIVNVKVEGALDRVQTRITHDEGA
SWTPLQPPSTDVDGRLTGCKFQPPSSSCALHLHAVLSIRNLGHVFSSTAPGLVMGVGSIG
DRLRPYAECDTFLSTDAGLTWRMVARHPHRHTFADQGGLLVMAEDASSVDTLLYSFDYGS
TWTKLPLPMPIEPVVLTTAPDGTALKLLLMGSRPRGTASLKERHVAIFLDFAGLSKRKCA
ASDFEKFYPATPHSSCLFGHRQWYMRRKPQADCFVRDKFHEPKGHDEPCACTRADYECDM
GFVREQGECRLKIKLPVPPGECVRGAKTFKGPSGYRKIPGNTCEPDPKHGTPALDAPIDR
PCTDAVPAAGSVSHVKFEFPSRVADILHFPASPRILARLYSGDVYQSTDDGSSWHALDLR
VPGHRASSVLQLVQHPHDKQRAYLITQGKVVHYTRDGGVHWKWFEAPIEANGVGFDTMGF
HAQHPSWVLWTGSRDCLGDSHACQTELWYTKDERYVDWRRAATHVRKCAFLRATMDFTGG
DRDVVCELEEAPETQNHRGRGSKLLPGQRSTPRQVNLVVGGEFFTRGRRVVMPDILGFSV
FSQYMLVAKLTRADSSAVPSSPSSAGSVSSSLHMHVSMDAHTFAPISLPPMLDLAHSAYT
VLDSVTRAVFLHVTTTRAHARAQWGDIIKSNSNGTYFALSLPNVNRNAQGFVDFEKMQGL
DGIAFANVVANTDDASVSGVKELRTVITHNDGGSWNPITMPSHDSLGAPYACDHVGCNLH
LRNLLERPNLRVTLTSPSATGFMLATGSVGRSLKPYEECDTFFTRDGGFSWEEMRKGTHL
WEFGDHGSVIVLVDDTQPTDSVEYTLDQGLTWHVYHFGERMHVHMIDTVPEDTKRKFVLL
GEAAGRSMAVFLDFSHVLSRACEWDAKDEVRSDFEKWSPSQQRAEPCLFGQQTWLWRRKR
DRICYVGDVMPQQSVEKTPCTCSAADFECEFNHFRNATTGVCVPYAGVSAPVSPTQDDHD
TQCARDAPDYDGFWYERTNVRKIPLSRCLGGERPDRGRRHRCRSRYGIGTVLWYLVFVPC
LLLGSWMGVSWLLMQRERGTITLPELEHIPIVHHAMSHAESGIHVARGYVSMIWANILAF
LHDMPITRDILRRSERPFSHYHMLSTDEDAEILQGYDASDIEE
Download sequence
Identical sequences A8Q677
XP_001729887.1.82384 gi|159103781|gb|EDP42673.1| gi|164657522|ref|XP_001729887.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]