SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|212212651|ref|YP_002303587.1| from Coxiella burnetii CbuG_Q212

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212212651|ref|YP_002303587.1|
Domain Number 1 Region: 32-92
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.92e-18
Family Thyroglobulin type-1 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|212212651|ref|YP_002303587.1|
Sequence length 110
Comment thyroglobulin type-1 repeat domain protein [Coxiella burnetii CbuG_Q212]
Sequence
MRSFIYILILLLLIFAFSTLIKRHDHLRQENSCLHIRKTLLAKTLKPKDTYIPQCTLYGH
YIPKQCNQSTGECWCATIEGKEIPGTRTSSGKTPKLCKLNWFYELYRRMQ
Download sequence
Identical sequences A0A2K2ER12 Q83D46
227377.CBU_0898 360115.COXBURSA331_A1049 434923.CbuG_1104 434924.CbuK_0763 gi|212218376|ref|YP_002305163.1| gi|212212651|ref|YP_002303587.1| gi|161830066|ref|YP_001596808.1| gi|29654221|ref|NP_819913.1| NP_819913.1.72601 WP_005768751.1.11896 WP_005768751.1.15899 WP_005768751.1.18645 WP_005768751.1.18990 WP_005768751.1.20088 WP_005768751.1.25364 WP_005768751.1.31144 WP_005768751.1.35092 WP_005768751.1.38839 WP_005768751.1.39746 WP_005768751.1.41753 WP_005768751.1.44545 WP_005768751.1.460 WP_005768751.1.513 WP_005768751.1.53098 WP_005768751.1.55037 WP_005768751.1.55635 WP_005768751.1.56161 WP_005768751.1.57074 WP_005768751.1.6787 WP_005768751.1.68745 WP_005768751.1.68840 WP_005768751.1.72017 WP_005768751.1.7296 WP_005768751.1.73073 WP_005768751.1.74283 WP_005768751.1.85884 WP_005768751.1.88235 WP_005768751.1.8942 WP_005768751.1.92481 WP_005768751.1.96664 WP_005768751.1.9866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]