SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|568285251|ref|YP_008973435.1| from Leisingera methylohalidivorans DSM 14336

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568285251|ref|YP_008973435.1|
Domain Number 1 Region: 268-437
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.14e-25
Family Polyphosphate kinase C-terminal domain 0.056
Further Details:      
 
Domain Number 2 Region: 14-95,163-230
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.51e-19
Family Phospholipase D 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568285251|ref|YP_008973435.1|
Sequence length 495
Comment phosphatidylserine synthase [Leisingera methylohalidivorans DSM 14336]
Sequence
MQQSLPPEEHRCGEFAVLITAEQAWPAFERAVLDARREIIASFRLFDFATRLLSPEAQKT
GGNWADLITDALRRGVRVRLVVSDFDPVMAAPLHAAAQKTLEQAQEIAAQLSPEQVALLS
VSAALHPARAGLLPRLAFSPFVLRKLRKLPKRLRPAAASRQRLPQLCPVSQHQKIAVIDR
EVLYIGGLDLNRRRFDTQAHDQPAHETWADVQLMLRGPEAEEAASHLERFQDETALRRRP
PQGKHIRRTLSVPRRGGFWALSPRTVLKEIEEDHLEAFGQARHLIYLETQYFRSSPIARG
LADAARRNPDLSLILILPALPEEVAFNEDCGLDARYGMALQAEALQEVSAAFGGRACIAS
PVQRRMAARVSPSVLAGSPMIYLHSKVLLADQNFAMVGSANLNGRSMRWDTEAALRITQQ
DRIGQLWHALARHWWQEDLPAEALDPVCAAAWWQQEIRRNKIRRPEARRGLLVPHDPDRM
AELQQPLPGATEDIV
Download sequence
Identical sequences V9W028
gi|568285251|ref|YP_008973435.1| WP_024092016.1.64

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]