SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|ChlNC64A_1|132994|IGS.gm_1_00130 from Chlorella variabilis sp. NC64A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|ChlNC64A_1|132994|IGS.gm_1_00130
Domain Number 1 Region: 34-116
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000866
Family Fibronectin type III 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|ChlNC64A_1|132994|IGS.gm_1_00130
Sequence length 248
Sequence
MFPHRGVLVVGFLVACGSACHAQLLLGAGRAGCPKPKALSAAATSDTAVSLTWQAGDGGS
PATCGGYLIAIFKDGQPAGSGKSFASSVPAAIISGLSRGATYTVQVRALSRLGLAASEPA
QLTGVATSVPSPAASSAAAGASGSAAEDAWACVAAQGYPVCAAGSAGLCTPITCAEMARL
GRCAAPYIRVQDWQRRTLTQHCAAECGGCAGRAVPRLADSMAPPQAYCCAFNTGAYFAGP
GGAAVAAK
Download sequence
Identical sequences E1Z241
jgi|ChlNC64A_1|132994|IGS.gm_1_00130 XP_005852031.1.22496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]