SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|ChlNC64A_1|133829|IGS.gm_10_00120 from Chlorella variabilis sp. NC64A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|ChlNC64A_1|133829|IGS.gm_10_00120
Domain Number 1 Region: 807-929
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 5.23e-18
Family Barwin 0.052
Further Details:      
 
Weak hits

Sequence:  jgi|ChlNC64A_1|133829|IGS.gm_10_00120
Domain Number - Region: 218-272,387-422
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00279
Family Fibronectin type III 0.011
Further Details:      
 
Domain Number - Region: 908-978
Classification Level Classification E-value
Superfamily PHL pollen allergen 0.0667
Family PHL pollen allergen 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|ChlNC64A_1|133829|IGS.gm_10_00120
Sequence length 993
Sequence
MAEWIKTNTAKLKTQLLPDVALAQTRVIMSIDVDAVAECFGYPGYVEIDPPTLRKSQCTS
DPPTLSTLKLDLTDGYVGASAMHFDIFKDKGNPGKYVIRTIARNEDFCPTYVGVSANCDA
AAVILTGVEDRKTYWTMTAGRGFYTFSTEIKNGNTVLCKKFLAIRKPTACPAAGAVTLTA
PRLPGAAANPDDAFLATYNINFRLARPVPSDASFGRSPSAPEIVRVASAPDGKFTVTLAV
PDFPGGADVSTYDIVGRPKSGAANPKVLLVNTAGQVDPNNARQRIFTTAAGGRWQAAHDF
VAYASNRFGRSIASRIEVYYPPPSPGPPTIGSVGVVNGAIEVEVNPDWDPDGYAGYTFEV
AGTALEGGANIAVARTAGQALPNDAFALRFAAGAHRSGEVYSINVFAYNQLGLKSLGSPS
VTFLEKPDAPRINKLSVNEAGAGVLEVTITPPASSLVFEYRATGVPATGPGNIVAGPDEG
DPDETSFDLPQPVTLRFAAAAQQQGIEYTITVVAIYVRHPAACWVCESDATWQKARLIAD
AQQSSYTAGWSALGGAAFAFANTTVTGGGYSAYQAFNNLYNPETAMWGTTGTSSTLSSTN
LTCAWWFPTSSLAGVKPAGSPRYWGVRLTVPASDKVSDKWPLMLFMLSEVAPSAFSFATP
LAATFWTAPSTQFCALLMPQMALSNKGKVLSLPCMAGGSTFVSDAKYLVGFAIQDAGTKS
VPRWSELTKTGYERYRASNGLLMCRKRNGVIISDSEPGSSPPPAQPRPPRPKRPRPPRPP
PPASTPAPATKVYSGKAGASGGEVSSGDGFSCPYPRLSKWQRLYYAAIPTSLWDDSKPCG
RCALVTCVDSRCKVPGRQVAVFFVDQCDSCGTNGFSTSSPAFLELTGLKPDEVKVEWQYT
SCAPYTTGSIRLDPKSGGNKWWQELYIYNSAEGIESVSLDGTPLKRDTWGFWVHDGEFEK
GGKHELTIRGESGRALTATVSDVLKSQDLGIQF
Download sequence
Identical sequences E1ZFB9
XP_005847576.1.22496 jgi|ChlNC64A_1|133829|IGS.gm_10_00120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]