SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|ChlNC64A_1|136234|IGS.gm_15_00330 from Chlorella variabilis sp. NC64A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|ChlNC64A_1|136234|IGS.gm_15_00330
Domain Number 1 Region: 18-71,108-154
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000602
Family Fibronectin type III 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|ChlNC64A_1|136234|IGS.gm_15_00330
Sequence length 171
Sequence
MFLPSSKTSHDLLNPFRALSNCSVPGAPTIDGVAAEAGGDLRIAVLPPATDGGSSITAYF
ILGLPTNGGPILAAGGSLGQPAVDDAAATKTWGWLALGSSSSSSSSNPTTGRRASLFTLP
AGSWQPGRTYRFLSWGVNSAGRGPDSAPFEFTTPHSECGALLSTVQSQLRR
Download sequence
Identical sequences E1ZJ98
XP_005846201.1.22496 jgi|ChlNC64A_1|136234|IGS.gm_15_00330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]