SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|ChlNC64A_1|140787|IGS.gm_3_00526 from Chlorella variabilis sp. NC64A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|ChlNC64A_1|140787|IGS.gm_3_00526
Domain Number 1 Region: 44-153
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000568
Family Fibronectin type III 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|ChlNC64A_1|140787|IGS.gm_3_00526
Sequence length 314
Sequence
MPLMLPPPPSPKPPSPPPPSPRPPSPCLGHNVPCSAWFCCAAYTCANTTTNSTACATKPQ
PPSSVYLSPAGRSVLVYLSLPPDTGGINIPITSYRILGRAAASDAPKIRKEELGTATADP
NVTYVEIEADEYSCGEDYEFTVWASNEVGESEEPHGESITPCLTQGTPCASYFCCASLAC
INNTAGAAVCAGVPGKPTSLFLSMDGKVLDVIVRPPTQTGGDDIGKCQAGARKALRAITG
YRVLAQSSTGANFTTTSPGSPSSLIPGTRVIEIAPDVYQCGVPYAVSVWSINDAGQSAEP
IEYGNGSNTFTPAC
Download sequence
Identical sequences E1Z676
XP_005850702.1.22496 jgi|ChlNC64A_1|140787|IGS.gm_3_00526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]