SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|ChlNC64A_1|140907|IGS.gm_3_00646 from Chlorella variabilis sp. NC64A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|ChlNC64A_1|140907|IGS.gm_3_00646
Domain Number 1 Region: 663-708
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000673
Family Fibronectin type III 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|ChlNC64A_1|140907|IGS.gm_3_00646
Sequence length 1400
Sequence
MLGSTRSGQQGQRARGAGSEAQQPGTSRAPHHSPGGGATNYRVVYSSDDSLSDGELHVER
RQGSISAWYQRGSAPTSEAAASSSPRHQPARQRRSPRRSTSASSRDSGSEGAAPLRSSVT
VVLHDHAGGSQDREEEEGPESRGSGGCAPGGDSEGGGGPASLAVGQQELQGMINWETNNL
FDYLRGLCQQGDQAGTSREAHLGQGQDSEEWARRLSALRQLLRERDGEVAELQGLLEARQ
ARLEEQGAELARQARRVAALEESGGTAPLASFPTYTSEGEPAGMQRDEYGQVLHNKRQLA
AAYQPAATASDAYFVQLPAQSYAAYSGCGFWQSVAEAAQRRPRRVGLAAAALLLFLLIVL
CATLIPAAQRRRAAPRFLAAPSLAATGATWIDVSVQVDRPAVVSYMAFRQADLNTQVPGL
GRTLLELIQGEEVQAAAVVAASAPSAGAAGAGFGSSSSSSSSSSSSSSSAQLSGLQQLAV
ACSWSSADAATGSGGSSTVSVLSAAPAADAACTGGGGASARCARCPQLHDGTGYTLLLTA
VGASGRGLSAVQVVNAVTGEAAVNVNGLEPPYADNATATSFDLHFKLNAPGTLYYAVAHA
RLFAPYGARQLAYGALTPPSAAVVAANPASFLGGLVANGSTAVAAAGQWTSLRVDPPCVA
ALCRETLHGLQGGTEYLVFLVAVNNYGAVDPAPAVAAVTTAAATSAPALLPPTAPSNISD
SGFGMAVSMDAAGGVYFSLLAAKPGVTVAAEADGIAAGSWAQMGSLLPGVDSRRRLLGAA
GGAARVFTPASPQLRALLAGDSPVPPGTLVAPTCYPMNRTCLLEAGAAFAGVDGLAGSFD
VLASGCTEVPEAGRAVALPPFSGLQNDTLHYLLLSTEDTAVPQPNRLQPPAVFAVHTVDL
SAPRLACGFPVAANITSTSFSLAAMLTKPGASVFVVVLPAAAAATPPTADEVLRGTGAGG
AAAAAAGNLTHWGSLPWEVPGVAADPRKLWAPVTGLQSGANYTAYLTVTEDGGAPLHGGA
VAALSGILTPSTAPPTFTRLKGLNASVDEQRGTFSVQLSTDLDRAGQVYYALYRNYTCIR
GEPTVADIVAGNPLPPSVCKCDDASYCALVTAGSYAVPGQTLSAVHSVGGELSPLPFQSL
RNASEAQLKCFQGGLGQATDTYNIYLVAGSALPTHTGLAPQCGHLAQAAATAAAAAAQPG
ADPGAGCPAAPRLACAQAQLRPDSQVLQAGAIQPWPLNASGGGGAGPLEWLPPAGAAAVG
RPAKTQLSLEGGAAPAFAWGPAFPPAMRTGGSFGMQFALDKPALLIYAVFRPMPIDASGN
PQAPVLIATGRVPVFDAGANATTGAVAACPWAPGGAMQPQAQYYITFIARDKYGRMDGLC
PGQQPGTAPRVCTDLAFTWV
Download sequence
Identical sequences E1Z6H6
jgi|ChlNC64A_1|140907|IGS.gm_3_00646 XP_005850752.1.22496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]