SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|ChlNC64A_1|141044|IGS.gm_30_00082 from Chlorella variabilis sp. NC64A

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|ChlNC64A_1|141044|IGS.gm_30_00082
Domain Number - Region: 18-94
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0031
Family Fibronectin type III 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|ChlNC64A_1|141044|IGS.gm_30_00082
Sequence length 479
Sequence
MFMYTVCISQRSGGFYKIDLTLEPPSDDGAMYVAISDWEVTITPSRPSFPAISFTESPFF
QSKKQNIEGFACGTTYTIATRAKNYAGFWSELSYYNYTTPACPSNPECTYDLATATGNTT
SRAVGPIASISPPNCPTLLLTNPVSTNDGCSEDPALLVNAAGVALSATSACVPAAGRANG
LTLAAAPGSEAVTMRSFQVGASRLRGPEALEAPSSGPTLVLGAQITWAFVDVDSGDVATA
TIPAATLASAEQRLDVVFDSAPSPTVPVTDASALQVGVAADFGVGGDGDAWQSIRYLRTW
LPTDCTWSMVYARPSTPVSGGQPYCSTMELGGLDREGCTPPDPDEFYSLFAEASDSGVKL
TLHSVCNWQWGIYGANVYSLTPSGIDMLISSIDVGVVGASVDVARPIMLSVASGQLPPQN
FTIPANTLAKGQSCCVTQPVALSGGLLLLEGQPAFFRWFAEVVDTNELESYIHLKALKP
Download sequence
Identical sequences E1ZS13
jgi|ChlNC64A_1|141044|IGS.gm_30_00082 XP_005843508.1.22496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]