SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|ChlNC64A_1|143404|IGS.gm_56_00003 from Chlorella variabilis sp. NC64A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|ChlNC64A_1|143404|IGS.gm_56_00003
Domain Number 1 Region: 89-218
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000187
Family Fibronectin type III 0.0091
Further Details:      
 
Weak hits

Sequence:  jgi|ChlNC64A_1|143404|IGS.gm_56_00003
Domain Number - Region: 255-290
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0727
Family Fibronectin type III 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|ChlNC64A_1|143404|IGS.gm_56_00003
Sequence length 413
Sequence
MAAVRNGVLSVWVVPPQIVGDPGGITSYTVRGVAVGISSSVPLSTIEATGKGNTTTSQPR
FDFAPGKFLSGRNYSITVRATNRRVALGDQLHVTVDPPTVVGGPGDIIRYFVTGLPIGGG
PTIRVNGTGEPTRLRPGQVRFTFAPGTFRSAQLYNLTAAAENVMGRGPAGAALPFQTPRS
KPAAPSVVDITINRNGSFSVWIVPPIFVGGPGSISYRVLGDAADPTKGNLSLRSPGLPSS
GGRVRVTFAAGTFPPLRTYLFYAFAKNDVGDGDPSVQDIQFTTPANFPPPSPPKPPPAPR
PPRPPRPSPPRPPAPPQPPAPPTPPPPPGLWRSATCSQPDDAPPNFVFSKARPLLDLPYL
FEPDYAFSPDSVMGGDYSATTIFSTFYSPRAPMSRPNNASDRHCSWWMRTPPA
Download sequence
Identical sequences E1ZU29
XP_005842781.1.22496 jgi|ChlNC64A_1|143404|IGS.gm_56_00003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]