SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|ChlNC64A_1|143994|IGS.gm_60_00001 from Chlorella variabilis sp. NC64A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|ChlNC64A_1|143994|IGS.gm_60_00001
Domain Number 1 Region: 926-1073
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000073
Family Fibronectin type III 0.0057
Further Details:      
 
Domain Number 2 Region: 502-644
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000019
Family Fibronectin type III 0.0063
Further Details:      
 
Domain Number 3 Region: 840-914
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000714
Family Fibronectin type III 0.0071
Further Details:      
 
Weak hits

Sequence:  jgi|ChlNC64A_1|143994|IGS.gm_60_00001
Domain Number - Region: 657-736
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000252
Family Fibronectin type III 0.0064
Further Details:      
 
Domain Number - Region: 352-402
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000476
Family Fibronectin type III 0.0074
Further Details:      
 
Domain Number - Region: 1115-1186
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000558
Family Fibronectin type III 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|ChlNC64A_1|143994|IGS.gm_60_00001
Sequence length 1225
Sequence
MAYKNTLMRMAPGSTILPVAIEPDDTGQSIHTVALFPGSVAAGVVAAQQLAAKLRAGGLN
AYFDQRKFGRVHAEVVADPYLADSTGDTIPSLPGSRPVAMITVKWYDLPPDQVTAQKRKA
YVAAIQKLVPGSLVTYKTHLDDGDWTGAGGNPALQKLAMDTLMSNAAPTTLAKALNTMRT
RPASFGQMASDDGYAVRWVPDSSFVSPCDVRTTLTLTGIIVYAPSCTRQLVTAYLAALKT
KLPSDVVTSVVSAMHVSSGCSVVTSSAYPGSQQGAAMDLAGRLVPSNYPLNGTVFGAGSK
TPVFFAEGAAATGQQRGMVTARHLLLDAAAAMSPTTGKASATPIPGSAFAKYEYKLQPVN
CAPGKSCPTLTFTFATADAYFSGLSPGTTYKVTVTGISQNGERTEGLGTQARVQFTTPAG
FMLTSATATGPTTGAATATAPAGAFFKYNVTVEGISKTGQRTAGQNTLQFTTPASVHLES
AQATSSTTATATATTQPAGAFPQYMYSLRKLGCITCKSLNFPSSTATVKLNGLEPGAMYN
VTVEGISKTGQRTPGDNMLQLTMPAGLRLTQAKATGYTTGTATATALPSDAFTKFVFTVT
KARCTVPPCPTLAFTSRAPSNQLTGLEPGTKYNVTVLGVTKTGQRTKGANMMQLTTYMFT
VKKALCPGCPKLEFNSSTRMGTFTGLAPNTAYAVTVAGVDWSGRRTQGSNSLQFKTPTKS
APPPPPTPTLKLTSARATTPTTAIATASPQPPGAFVKYNVTVAGMDKSGRKTQGINMLQF
KTLDAQRPPPRPTPAPGLNLTEARGLNPTRGMARVSEKPAGYFAQFIFTVKKAACPSCPA
LHFTSNITLGVFSGLTPNTTYQVTVVGVDKRGQRTPGSNALQFRTPASGFLRTPPSPPPV
APKSLRLISADATSPTSGTATAQPQPAGAFVKYIFTLQEVACPSCEPLAFSSTTSVGIFT
GLKPNTKYKVTVVGQDSTGGTTAGSNMVSLTTQPFSEGPSINGTESVTATSGIIDLLPPS
GLTCARFIVEMCPMPRAVAPCFNRTCTSPKCFVDGLQPGTVYGVTAVCREGNGQETGWGD
EGTLTTLPALSMKSAAATGPFTGTAAAEPQPSSAFKEYIFTLKEAACPSCVALVVRSNTS
VVTFTDLKPNIQYNVTVNGVDTSGSTITGSGMAQLTTQVASPPVPPPSGICPGYQQHLWH
GHGHSPSRWKLHRVHFHGTTFVRRA
Download sequence
Identical sequences E1ZU34
XP_005842778.1.22496 jgi|ChlNC64A_1|143994|IGS.gm_60_00001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]