SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|ChlNC64A_1|144877|IGS.gm_8_00205 from Chlorella variabilis sp. NC64A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|ChlNC64A_1|144877|IGS.gm_8_00205
Domain Number 1 Region: 38-209
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000103
Family Fibronectin type III 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|ChlNC64A_1|144877|IGS.gm_8_00205
Sequence length 379
Sequence
MAVQRVAAALLLLLLAASAAYGQEVRLVAGPGCLADQVPSPPVGLKAQPLDGGVRLSWDR
PANGACVSEYQITVVRLNTTQRAAPLTQKTPDFQVTITGLAYSSRFNAGGEAQVVATPAA
ACNPALLPSAPTNLTATPGNGQLKLCWGPPTVNGCVDEYRLAIRAVQQDPQRSFSPIYRR
INTGACATIDRLVNGVAYEASVQAWSATMRGGGYASVRATPIAPPKPWTCLPAPGSYPLC
STAAAGRCTPLTCRQQVAAGQCFAPFMRVVDPASRVVVQYCSDVCGCSADPAAKEPAVRA
FDNGVTADTAALAGQADAATRAVAASASSAARAAATYQTDSACCASPPRPARRDFGFGLP
ADVALGAPQGQPEAEEYSP
Download sequence
Identical sequences E1ZD76
jgi|ChlNC64A_1|144877|IGS.gm_8_00205 XP_005848270.1.22496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]