SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|ChlNC64A_1|145075|IGS.gm_8_00403 from Chlorella variabilis sp. NC64A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|ChlNC64A_1|145075|IGS.gm_8_00403
Domain Number 1 Region: 729-891
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000164
Family Fibronectin type III 0.0044
Further Details:      
 
Domain Number 2 Region: 915-1080
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000073
Family Fibronectin type III 0.0068
Further Details:      
 
Domain Number 3 Region: 1103-1270
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000128
Family Fibronectin type III 0.0058
Further Details:      
 
Domain Number 4 Region: 200-345
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000043
Family Fibronectin type III 0.0061
Further Details:      
 
Domain Number 5 Region: 1292-1454
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000139
Family Fibronectin type III 0.0061
Further Details:      
 
Domain Number 6 Region: 554-685
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000738
Family Fibronectin type III 0.0067
Further Details:      
 
Domain Number 7 Region: 290-463
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000791
Family Fibronectin type III 0.0045
Further Details:      
 
Weak hits

Sequence:  jgi|ChlNC64A_1|145075|IGS.gm_8_00403
Domain Number - Region: 108-163
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000332
Family Fibronectin type III 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|ChlNC64A_1|145075|IGS.gm_8_00403
Sequence length 1511
Sequence
MQYNVTVTGISNDGKRTPGLNQLQLTTPTDVSIWLTEAKATGPTTGTTTASSPSGAFTKY
NVTVEGITKTGKRKPGLNMLQFTTPISVHLESADVTSATTGTTTASSIPGNAFTQYVFTL
KKVGCPTCKPLTFTSRNVTAKLIGLEPGATYNVTVTGITTTGQRVLGDNWLPLKMPAGLL
LTKAKATGYTTGVTTARSLPGDIFTKYVFTVVKANCTVPPCATLTFPSRTPLAQLTGLEP
GTKYNVTVVGVTKTGQRTKGSNMMQFTTPAPAVRLTTALSATRGTANATALPNGYFAKYI
FTVKKANCPTCPVLVFNSTTTTGIFPGLTPDTLYNVTVVGVDKSGRITKGGNMLQFKTPK
TDALRAPPPRRSPKPPPPKRPPPPPSPTIKLIFANATNSRRGRAIAEPSRAGIFVKYIFT
VKRANCPTCPPLVFNSSTVNGDFPGLTKGTLYNVTVVGVDKNGRITKGSNMLQEPSINST
EPVNSTSGIVDIIPPGNLQCVSFKLHLVTVICVLANGTEVSYPSGSKLTTPPALSLTSAS
ATSFNSGTATADPDPNNAFVKYTFTLVEASCTSNCQLLKFNSTSVVGTFTGLKHSTKYNV
TVVGTSSNGTITQGSNMKDFTTPSPPPPPAPDTSVINSTEAVNGTSGIVDFVPPGNLQCA
SCQVNGLSPGVKYSVTVICVGADGSKTEAPGTGTLTTPPELSLTSASATSFNSGTATADP
EPDAAFVLYTFTLVEASCTSNCQLLNFTSSTTTGIFTGLKHSTKYNVTVKGTDSNGTTTQ
GSNMKDFTTPAPPPPPPPPPPGQPFVNSSEFANATSGTVDIIPGTNLQCQGYKLRLCPVR
PPTNDSCITAPCNGTKCAVTGLKPGTTYNVTVICVDANGNEIPSSSTSTLTSSPEITLVS
VNATSPYTGKAQAVPQPNDTFVEYIFTVVDLNCTSNCAPRIFNSSIPSVNFTGLTPGTTY
NVTVVGKDSNGTSTAGNNTLQFTTPAAPPPPAPFSLPSINSSDPINSTTGVVDITPPSTL
NCSSYILQLCSNGTCFNATCPATHCTVVNLTAGTTYNISAWCVGSDGGETPTDNTGTLTT
PPTLELKTADATSPFTGNASATPSPNNKFVEYIFTVVEAGCTSSCVPREFNSTTPNVDFT
GLLPGTTYNVTVIGRDDQGKNTTGSNMLQFTTPAAPPPPAPFSLPFINSSTSSNSTSGVV
DITPPTTQLNCTEYKVQLCTNGACFNTTCPSRCPVDGLTPGTTYNVTAVCLDSIMGEVPA
SNTGTLTTPPTLALASANATSPYTGSANATPSGNNPFVSYNFTVVEAGCTVNCTVLVFTS
STPEVNLTGLQPGTTYNVTVVGVDPNGTVTPGSNVGQFTTPATLELTSANATSPWTGVSS
AKPSDNNPFVSYNFTVVEAGCTVNCTVLVFTSSTPDVNLTDLLPGTLYNVTVVGVDANGT
VTPGSNVLQFTTPPLLVVLTTANATSTTDGNASASTPAGGNFTQYEVTVWGLKDYGAVIQ
GNNTLRFTTPA
Download sequence
Identical sequences E1ZCI7
XP_005848542.1.22496 jgi|ChlNC64A_1|145075|IGS.gm_8_00403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]