SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|ChlNC64A_1|50528|fgenesh3_pg.C_scaffold_4000027 from Chlorella variabilis sp. NC64A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|ChlNC64A_1|50528|fgenesh3_pg.C_scaffold_4000027
Domain Number 1 Region: 579-729
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000138
Family Fibronectin type III 0.0064
Further Details:      
 
Domain Number 2 Region: 44-155
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000664
Family Fibronectin type III 0.0073
Further Details:      
 
Weak hits

Sequence:  jgi|ChlNC64A_1|50528|fgenesh3_pg.C_scaffold_4000027
Domain Number - Region: 466-561
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000925
Family Fibronectin type III 0.0079
Further Details:      
 
Domain Number - Region: 378-499
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0105
Family Fibronectin type III 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|ChlNC64A_1|50528|fgenesh3_pg.C_scaffold_4000027
Sequence length 733
Sequence
MRPLTLAAICLAVGAKASSSAALPACLAEPRLEGQTRLCVHGAVSRPDPPTVVHVAADYL
NLLVVLTPPAFTGSDTILGYRVVGVPSGGGANLTLGGTRQLGMTLDASKRLLQLSMAGVP
LNRQYTFSAHTSNSAFESAASSPFTFTTPPPKPGAAASLDVQSSRENGIRIGVHLLYDQG
LSQAERAARAAGIAAYKLVLVPDGDGQALTATVNGPPAYDSSDGDYIYHFQFPEGWRECK
WYTINAYAINLDGDEAPASQLRYLTSCWVPSSDVTSVRLTPENVLEVVFDASKDAGLNIT
GHIVGVVPHTNTLPKVVIGSNRTLGAEQVGTGGKVRAAFLPNARARLVPGATYWVQVETY
YCNPLWDYFDPATCILRSFPGYIYVFTMPGRPANPTILSANHFVAEDVVRVVVKNGSAGI
SSYRLLGVPTTGAGTNITATAAYGGEATTVELRPSQDPRLAPGTYSPGRAYRLYAYATGM
AGEGPASAPTTFNAPLRPPVATGGAVINGYRILGVPQPAGSDPNITMGNKDSRGIFVTNQ
TGGGLTGFLVQAVRAAGAGPMVPLGGSADMGTDAGNGERQLSALLSAFPPGATYNFAAQA
INGAGSGPWSANVSLTTPIRRPSAPTVFFVSVHPISGDVLVTVTMGSSGGLPISMHRILA
QPTAAGSTAVSRNVTGAGLAVSSAQLMFLFQPGFGTGLSLGTAYNITAFARNALGEGPGS
PTYRFTTPPSSVP
Download sequence
Identical sequences E1Z7A7
XP_005849987.1.22496 jgi|ChlNC64A_1|50528|fgenesh3_pg.C_scaffold_4000027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]