SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|ChlNC64A_1|53489|fgenesh3_pg.C_scaffold_16000001 from Chlorella variabilis sp. NC64A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|ChlNC64A_1|53489|fgenesh3_pg.C_scaffold_16000001
Domain Number 1 Region: 1873-2074
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.21e-33
Family Adenylyl and guanylyl cyclase catalytic domain 0.0002
Further Details:      
 
Domain Number 2 Region: 1342-1534
Classification Level Classification E-value
Superfamily L domain-like 3.06e-21
Family Polygalacturonase inhibiting protein PGIP 0.0092
Further Details:      
 
Domain Number 3 Region: 2138-2296
Classification Level Classification E-value
Superfamily Nucleotide cyclase 0.00000000000133
Family Adenylyl and guanylyl cyclase catalytic domain 0.0069
Further Details:      
 
Domain Number 4 Region: 892-932,960-1033
Classification Level Classification E-value
Superfamily TPR-like 0.000000237
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Domain Number 5 Region: 1655-1780
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000553
Family Fibronectin type III 0.0063
Further Details:      
 
Weak hits

Sequence:  jgi|ChlNC64A_1|53489|fgenesh3_pg.C_scaffold_16000001
Domain Number - Region: 2383-2449
Classification Level Classification E-value
Superfamily Nucleotide cyclase 0.000102
Family Adenylyl and guanylyl cyclase catalytic domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|ChlNC64A_1|53489|fgenesh3_pg.C_scaffold_16000001
Sequence length 2763
Sequence
MAAPQLRGFALPGGFPAMRPAFALPGAPVRLRRPRRAAVPPASITARSGGRREERTAAAY
TPPPAPPPPAAASEPADAGSGWRTFWTAVDTSAWLGTVGTAVAFILTQEAMLAAAPVVLP
LLALYASRQRERLAVAAQQQAQLRRLELLLLELQVETADEVAAEVGAEVQELLAQVQRQR
AADGGASSAETAKLLRGVEAKLAAVEGSVVGTGAATREALQASAEQQGQVADSVMRRLQD
LGTALRRDVYGALQAAGGEEQRSLARIEAQLAALEGAVGGLQAAQSEGLMRLSSGLQAAM
LDAEGALQAAVREEAYRSLDPLRRLPELLKSAVPVTPEVLAPLDGSLPSLSEEGLRQVVG
EALAGATRDILDQQAALLEELAGTPQAIAPQQWNQLGVRLASLQEQLHELAALQAAAAAP
GAGGGGEGAAGEGSGAAAAAATAEVAAVAAELAGLRSELGSLTSSVQQLLEAQRLGGGGG
AAASAGGSVGAAVGLPPGALAGVAAAVQAVQDQVVLLRQDLDGDDPRYASFVALEQQLEA
ALEAMFDFLRDAPPGAASAAAAVPAAAAGGGAASPAAAAALEQSLAALGARLDGMGQQLE
SLQAGMAAVAAAPTPSPAAGSAVDPAAQQQEEEQKERQEEGADAAADAGAEPAGQEGKEA
AYRRMQLLLQQQSERRPDGEDAGAPASSGKAFAEWLSGHRENGALPAATASASSNGSAAA
LAAAPPGAAPGAAGPMPSGNGSGGGGGGVQGQIEFAAAVGLTVEEELIAVAAASYDAAFE
DGQPASARWQGEEQAAAAEVPYTGAKAPNAAYSEQRQEQDAQQQDVQQQQWQQQLATPPP
QAEEPAQQQQEAPPQATAEQLYERGVQRLREGRALAATPGADLGLADSALWEAADCFEQL
LAQHDPANLRARGNYGNALLSHGRLKKQMLDALAASAPADQAQAAALAAAAQRLAGEALE
LLLLAGRQYKAVLEADPSQAKAFINWGRVVGLRADMARAAGDAAEAGRLFGLAADKFDAA
LDLEPQNVQALRLGGQAVLDAALCTLGSDLREARALLKDAGSYLEAALALDPQDGESVAA
LERVVLRGASLRRGQARLESSEDKCVIEMPASQAATVAFLAGVYAGPTGAAVRDAVAASV
EVLPDKDFCQVVELAVRFDFPLLAQCLVAPSLLSKRIKSPACVHRMLSLAEVASVPVMID
LLSDVFVRRATPAQCCMDWVKLRLWLVVNMPLQCIYSETAHLTAVFNGGLKKVVQALCSA
EAQTMLSNIMAVVAAPEQPCCRVIADRCCPPASTRMAAARPPRRAHRRRIQPAPAPARLL
LAAAALVLATLAAPRPASAAIVPGDKAALLAFKQGLTAEGGDLLSTWVPATDPCLDGWTG
VRCSCHDFFAAPQDGNQSQVCTQPASLPDGRRVLQLNFGDPRITQWNTLTGTISPALANL
SSLRVLNFHANHLYGSLPPQFARLRVLEQLWLGGNRLTGSLPPYLSAFPFLRYVALDHNQ
FQGALPQQWCSGSWWQFDVEGNAGLCDEVPSCLSSRIASFAGTSLIDSINNQDKGMGGYC
GVDPPTCEPDLGCRFLRPDPPFFTNTSSISFAFSSFHSPLGGGTVRYRWALGTTRWGRDV
LDWQEWAGTNATQTVLTPAGGVVKRVYQVEWPLNQISLTPGQQYYVTVQGSNDAGQQLGT
MLSSQPVVADTTPPYLPDGSSVYSGQDFTNQAVQTEVNALAASWDPFQDDETDVASYGYQ
LDFDPAAQGEFRVYVINLDLQDGSAYFMRIYATNGAGLEGFRDAPPVTISSAGTCSSSAV
SVSKVVILVAVFVGAASALVALVTYWLMRESMRRHQAARKLQRGQMKNFKYLMQSLVQQT
GDAEQRQLEELKQLRELAFVITDLEASTAIAAAAPRQFEKVQEMHDSLMRELIGRYNGYE
INTEGDAFHVAFKDVQHAVLFCMEVQYQMMELEWPREVLRLGPCKEAKAPDGSLVYRGPR
IRMGVHWAAEGTVVQRLHQITKHRVFTGPAFQVTRELCEAAHGGQVLLSHEGWVHLRQDM
ATAGFPVVEQLGQYKVESWPAPIWVYQVTQLLGRPLHRQPGPLNFLEALEAGWGMSITRP
PQPHGPKGHLSFVAARLALEACPGGSSGTGEASPPVAKRLHEVLATVAMQFGGYIFRLSE
SQAAYLLSFASASDAVRFCHSAQALLMYSAWGQDSLDFCGRTELAPDGKPVFKGPRVAMA
VHQSCEFTAVSVPRQQAAADDVTTDYLGTAVERVQQLSEAAHGGQVIVSEKAWAAVQDQL
PGQPHVVSLGSHLLDPSPSSPPLLLMEVMPQVLLRRTFPPPRTLGMVEPGYRDAPAADEA
VAFVYVKVSKPAEVAEAEQVRSGVSDDTILRVLTAYNVALGKATKLMRGLLRQYRGYECK
EPEPGKLTLAFRQLEDAVAWGCALQQELLGFSWPDTVLEWDECREVRHHDSTNLLWRGLR
GSFASIRTPSLKRGASLQPGSGGRGRLRAHILAHGAAAGGLGSRRHSVEGMGVEEAHLVQ
FGDAAHEARSYSVASSGGSLMRGGWLGALGARISGALGRRSVQSGHPSELGSPRSATRLR
DAADWSYPGSTLTTPTTQAAGGGSEDPWDAGLAMEAALGGAEGLAPGSSHPPPPQRQLSS
GLPPRGPPPPHHHQHRASSASSAALDAALAGASSREPSQAGLLPAGRTSSSSSTPAFLEA
VEAEGIVAAVQAAAAHPGAEVASTAASGGSDSGSGSVEAPPVPALGVLPPWQSPARIAPA
AAT
Download sequence
Identical sequences E1ZK11
jgi|ChlNC64A_1|53489|fgenesh3_pg.C_scaffold_16000001 XP_005845824.1.22496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]