SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|ChlNC64A_1|56825|estExt_fgenesh3_pg.C_30016 from Chlorella variabilis sp. NC64A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|ChlNC64A_1|56825|estExt_fgenesh3_pg.C_30016
Domain Number 1 Region: 645-791
Classification Level Classification E-value
Superfamily Fibronectin type III 1.21e-31
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 2 Region: 789-978
Classification Level Classification E-value
Superfamily Fibronectin type III 7.34e-28
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 3 Region: 1076-1179
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.36e-27
Family Canonical RBD 0.00051
Further Details:      
 
Domain Number 4 Region: 85-307
Classification Level Classification E-value
Superfamily Fibronectin type III 3.6e-26
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 5 Region: 313-461
Classification Level Classification E-value
Superfamily Fibronectin type III 4.98e-19
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 6 Region: 457-586
Classification Level Classification E-value
Superfamily Fibronectin type III 9.55e-16
Family Fibronectin type III 0.0047
Further Details:      
 
Domain Number 7 Region: 981-1056
Classification Level Classification E-value
Superfamily Cyclin-like 0.0000884
Family Cyclin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|ChlNC64A_1|56825|estExt_fgenesh3_pg.C_30016
Sequence length 1521
Sequence
MEAHDRAGSWSSPEQRRADASKPILPASSAAAAAAAAAALARRPSTASSPATVAAAPAPA
PAPASQQKGDAPPPPPPPPEVVVKHPPGVPQAVETSTTAISLSWQPSVCAIHSQVSVAVE
YIVHYELQMQQVDDKGALHSDRWSAQYTGTASFVQVKGLRPGRSYAARVTAVPQVINMPE
AVVVASPPSDIMLVQTLPCPPMGQSAPQLASRMKKELKFKWAEPEESGGRPLEYVLQMSP
APEGFEGGSGAATPDGFYQVYRGPERAYVAKRLVPGVQYCGRVKAINCEGESAFSPLAVF
YTQATVPSWSPSDAPFVWDTTASSVTLGWPEPASNGGNVTSYEVEMDDGSGSGFRLVTRS
LERQCIVQGLRSGILYKFREPDDDGGSPIVYYQVEVRPRCAAARRNLADDWSVYYQGPEK
ACTIGGLRAGCSYMARVFAVSEAGAGAFSAASILHTAPSTPGGSPVSAYRLEMCCLGPTE
GPHSDSGKGKGKLDPPFELAYLGPQCNAVLSGLEPGHRYALRCSAINEQGSSGWGHTAHV
ETLPGLPFPVDSMQLVAAASTSLKMSWCQPYGQGDPVASYVLEMATALSLPTLPLAPPPP
QLQQQQHDETAAVQQSDGQQQVPINGTLGGDAGVLDSYFQPAYQGVDCSCAVSGLEPSTE
YTFRMRAYNSVGSSVSEPKTFRTAPAAPSCPRDVDQQDATPSSLRISWLPPANDHGAPIT
GYQLECARSSSRGASSMAHAWKLAHQAGGLHAQVNDLVSGSLYLARVRAGNACGWGPWSE
PLPCSTAPDVPNAPAGLAARVVGTTVRTSWEVAEDNGAAIQMYELEMAGGGGQFTMVFRG
EGTSHRVQQLDPHSSYQFRVRAVNTVGAGPFSSVVAVQTSKAPPLPPQEVLAWAADHGSS
PNTVDISWVPAQQGTQEAVCVSYEVEATTGPSSLAVRQTCAGRITQMVLTGLQPGATYSV
KVRGVGADGAGHGAWSHPPAKRLAAAFVFLAAKVEEASLRTNDMLNAVAAHAAGATAGDS
AELARFPCLVGDAYQAAKRQLIQDEQLLLRYLRFDIGADQPHRHLYVLAHCWGASLGNLS
YDLTDQDVIDHFSQVGPVKHVRIVTERDTGKPRGFGFIEFFDIPTAESAIRNLSGKDFKG
RTIRIVYAEGGPGEFRSGRDFDDQRGPPSRFDDRGGPGGPGRRPMRDRVVGGDLAYHASH
GVAALLDAPLAPGAPADAITHLLARRSRAELYDYLAQMKGLLQRNPTQARQILVDNPQLA
KALFQMQVILGMVSNPLGDVAPKGVAPPNLMPRHEPPHGQGPPGPTPMGGPDGMMMGGPG
GPPPHMQGPPGAHGMEPPPPIMVGAPVQGPPMGMPGTSMPPQQQPPYMGGPMDQPPMGQP
YQPPPQGYMPPPQQQQQQPPPYMVPPEGMQGGPGYGLPPQQPPVQPSQPVDPRRMAVAGG
VPPRPMMSLATQPPPQQPQPPQPSMPAMQQPQPAPGGGALTAEQQQALLQQVMSLTPQQI
ELLPPQQKAQVLALQQQLGHR
Download sequence
Identical sequences E1Z6P4
jgi|ChlNC64A_1|56825|estExt_fgenesh3_pg.C_30016 XP_005850487.1.22496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]