SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|ChlNC64A_1|57034|estExt_fgenesh3_pg.C_40074 from Chlorella variabilis sp. NC64A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|ChlNC64A_1|57034|estExt_fgenesh3_pg.C_40074
Domain Number 1 Region: 755-910
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.41e-22
Family COMT-like 0.0000828
Further Details:      
 
Domain Number 2 Region: 185-232,270-324
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000268
Family Fibronectin type III 0.0063
Further Details:      
 
Weak hits

Sequence:  jgi|ChlNC64A_1|57034|estExt_fgenesh3_pg.C_40074
Domain Number - Region: 21-106
Classification Level Classification E-value
Superfamily EF-hand 0.00119
Family Polcalcin 0.079
Further Details:      
 
Domain Number - Region: 117-179
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00212
Family SAM (sterile alpha motif) domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|ChlNC64A_1|57034|estExt_fgenesh3_pg.C_40074
Sequence length 990
Sequence
MASLPAARAVLAACLLGCVLPLYAKTTHTEAEKARALETLFSSIDVNHDGQLDAAETEQY
AAASLDLLQEGWSARDASNAAQALDGPDAGATVSKAELAAHLTALLQACTCCIRDHRVED
WVSHGLNLPQYAAAFRQAAITALDFPFLVSDGGASLQAELGVVSKLHQLQILRGLKRLIL
GLGELPGAPRQLECAAANRSAVRLSWRAPRVPGHPALHKYALQRQRVVAAAGSAGAAAAC
AAGLGDGAGSGPRQGGVCVGVERWEAAGEPDDEDSSWVDLPPARGSYRYRLAAWSAFGRS
EYAVSGAACEVRAVHQRPPPSAPLPPAEVQALLAAVAATGSLSAGRTGGAAPGGAAGAGV
WSWSAASSAAVVALTILLKASQLKAGGLLLALWRSLTARVRRPAAGAAAGAADGAEQQQE
QQQEGGRDAAWAGMPRARSSQALLAALGSGAAAADEQQQRVGVASGGSMLRSYSSTQLLG
EQGGQLGSMGVEAAGWDAAAEAGEMDDAAAEQLQLAIQRGTRCAHPGCHRRFDRLRDMRR
KLEASGGCVMGGLPSRAGCLPSAATAAACHPWLTGLLLGSHPSETTAACRHFSWVQSHYC
CLCQYMYCLQHTRISPHGPRGGCGLESQCICHACFAELAPAQQAACERNNRLPSRRLAAA
ALLAAAAAWPAASPPARADAGSAPDAGSFYARWPYVQPGDILPYLRATAAAGDVDSVLAG
IDRFAGYYPMYRSVFAASQSEAGVPDVDSVADAGCGSRWCGPEKGAILERLVARQRPALA
LELGTFMGYGCARIARQLPPGGRLVSIEAREEQAAVAREVLRLAGLPVGEGPEARVQVVS
GLSGDVLPRLRELAGLHVGQAAGLVFLDHCKPCYLPDLVCMEELGLVGPGTMVVADNVMV
PGTPDYLEHVGAGTGLLGLSALTPEAVSSSSGGGSGGGIGTDGADGTERYCTYRTELLAT
MFEMEQRWKPDWQPQRDAMSVSICLPGTPA
Download sequence
Identical sequences E1Z7I0
jgi|ChlNC64A_1|57034|estExt_fgenesh3_pg.C_40074 XP_005850026.1.22496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]