SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|ChlNC64A_1|144451|IGS.gm_7_00393 from Chlorella variabilis sp. NC64A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|ChlNC64A_1|144451|IGS.gm_7_00393
Domain Number 1 Region: 7-78
Classification Level Classification E-value
Superfamily Cap-Gly domain 3.01e-24
Family Cap-Gly domain 0.00057
Further Details:      
 
Domain Number 2 Region: 175-285,336-450
Classification Level Classification E-value
Superfamily L domain-like 1.67e-23
Family Ngr ectodomain-like 0.035
Further Details:      
 
Domain Number 3 Region: 524-606
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000758
Family Ubiquitin-related 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|ChlNC64A_1|144451|IGS.gm_7_00393
Sequence length 647
Sequence
MAVQEPVAGARVLLGGKHRATVRYVGPIEGQQGTWVGIEYDEAGKGKHDGSHGGRRYFCA
HDPTAGSFVRLPKFLEAADFGRSLVAAALERYGLSSALERAAGGGGGGQPASGVDPAQQQ
EEQQQMYVSTASNRRVTVELLAPEASARRLSGAGAALAALVQHRISSLGSGSELRAMLPG
LTELDLSDNLFSSWTFVAELATALPSLAALNLSGNRLALPSPTLAPAAPPPAAPASLAGL
QTLVLNGCGVAWPQAVAVAQLLPTLRELHLCANGLASLHLPAAVGRSGCDVASAAEAAAG
ISLLLLGAPAAAAPGSGSSSSSRSSQGAAALLAAAFGRLEVLDLENNALSSWADVALLST
LPCLRSLLLSGNRLEEVRYEGGFTALRALLLGGNRLGSWEAASQLDRFPALEEARLSDNP
LTAAAPSTVRYQCIARISRLSTLNASAVSAAERWDAEVNYLRQVSDELAGAADVAGGSIG
GVEAARAAVLAAHPRFPALVQKYGELAPAAPRAAAGSALASSMAQLTICHGTKRVEKKLP
VTLTIGKLKLMLERLLRVKAAQQALLLVPPEGSASQPEDVSDEEGRELRYFDVADSWRLE
VRVADPAARAAALAAAKAAATAAHAARMEQHEKAIQQFRAVEQRLMA
Download sequence
Identical sequences E1ZBH0
XP_005848954.1.22496 jgi|ChlNC64A_1|144451|IGS.gm_7_00393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]