SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|212633180|ref|YP_002309705.1| from Shewanella piezotolerans WP3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212633180|ref|YP_002309705.1|
Domain Number 1 Region: 33-104
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0000267
Family Coronavirus S2 glycoprotein 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|212633180|ref|YP_002309705.1|
Sequence length 215
Comment hypothetical protein swp_0278 [Shewanella piezotolerans WP3]
Sequence
MKKILSVTIISASLLLTGCQSAYYGAMEKVGYHKRDIMVDRVEDAKESQEEAQEQFSSAL
EEMQALLNHDGGDLESAYNKAKDEYESAQEAADDVTKRIDKVEDVAEALFDEWQTEIGEI
SKASLRRSSESKLKETRRSYTQLVRSMRRAESKMPPVLTAMKDNMLYLKHNLNAQAIGAI
KGEFTSLQTDISGLINEMNKSIDESTKFIAALEGK
Download sequence
Identical sequences B8CHJ2
225849.swp_0278 WP_020910501.1.101980 gi|212633180|ref|YP_002309705.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]