SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi3|1020879|fgenesh1_pg.234_#_1 from Fomitopsis pinicola FP-58527 SS1 v3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Fompi3|1020879|fgenesh1_pg.234_#_1
Domain Number - Region: 161-195
Classification Level Classification E-value
Superfamily HMG-box 0.0517
Family HMG-box 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi3|1020879|fgenesh1_pg.234_#_1
Sequence length 775
Sequence
MRVPSNARDELRALHYASGVGRASKGGSDDANTSETRWKTRGSCQYITFPMCSKQTWSDK
QMKVMIIYLADFRDAPDDDRRVDIINRALEEMDTIGAPAPFPAQATRVTAVRKWLNKHVD
MLDETPREAKGSTRGCDLWARKHARLVHDHAYLQGNYNGLDPLKAYNKARWELWQGLADE
EKKEWNRKGETARALVTKDLSKVEPPLHTAAAVCKMLRNKFDAWQKKIYVETGAVVINIS
MVRTIDEGLVFTFDDATKQFGAQCNFKELLQKQGWKATELWARIIQHFNSMGNPAEEEPK
ILPSGKTSTAKPTTGFGSLYELGDDGLPIIPPEEQLNARVAATAKYWSAMVRQFLNAHQA
AASNNRSHSIPWTTAKEMGSMDVWFPAQMWPAHIPIKDPSKISKEDCIALVYLWRQAQEL
VGFRFRNWIDKAGNIEETNYEGFVNCWMQDAPHREKRKAAAGARQADQMNATRVQGTAVP
PPYFSPQERVSATMEAPGKQEDEVGAKGKAKGGTGEKAKSKGGGKKGKARDHRPDASGIG
REKAIAPPPQSAASGSGRSQAHEDSALASSGNPLEVEAEHVGRVSALAPPSPMTGPDLAR
SPLPVERPLPKRVLARNWKDLAPADLQVPERYGFLKSLSSEPNFQALLTACIRAKAVSES
NAKPRPASPEIQGACWSTWKWDKVYLPDSAHSSESGLEPLFAYLRKGRPKWEQDALELAK
AEQVLLTVGMALRDLYAVQFAHDPEDLPQGVPAYITDSKLSFAQVAQLESALEPM
Download sequence
Identical sequences S8F181
jgi|Fompi3|1020879|fgenesh1_pg.234_#_1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]