SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi3|1022407|fgenesh1_kg.9_#_61_#_isotig09188 from Fomitopsis pinicola FP-58527 SS1 v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fompi3|1022407|fgenesh1_kg.9_#_61_#_isotig09188
Domain Number 1 Region: 12-65
Classification Level Classification E-value
Superfamily HMG-box 0.000000038
Family HMG-box 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi3|1022407|fgenesh1_kg.9_#_61_#_isotig09188
Sequence length 67
Sequence
MVTKTAQSDATKKVPKKKGSAGGRKKLTPFNKFMQTEVARLKEQDPNMPHKERFKLVIEN
WNKQKAK
Download sequence
Identical sequences S8FQ92
jgi|Fompi3|1022407|fgenesh1_kg.9_#_61_#_isotig09188 jgi|Fompi1|120944|fgenesh1_kg.20_#_47_#_isotig09188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]