SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi3|1048193|gm1.3873_g from Fomitopsis pinicola FP-58527 SS1 v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fompi3|1048193|gm1.3873_g
Domain Number 1 Region: 81-168
Classification Level Classification E-value
Superfamily HMG-box 3.93e-18
Family HMG-box 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi3|1048193|gm1.3873_g
Sequence length 588
Sequence
MPPTRAPGLRDALRRRSSLISVPYPKSIKPGVYASPNVTFAPNVTPVTYNDQDDLFDETK
LAESSESALFPPSQDLTTPRPPEMKRRTGGKRRSESHIPRPPNAFMLFRADFVRQKHVPG
SIETSHVSLSKIIGNIWRALPLEEKERWWAQARKAKAEHKIMYPDYKFKPVHNKNKKKAK
DAKATPTPVSEDDDLRADVVAQLMLDGKKGDELVAAVRDWESSTGSVTPDASFGLEQPQA
SSSTFGMDQPQASGSNIPLYNPMPLYAGGRRSSSVPPFATYGHIAIPSVPFLMNAYPGGS
RAPSPVSHISGMSRGFLGQRRASSVQPVPSQSWGFSTAVFGPPPTYAQPSPYGQSAPSPL
PEPDTSLFQSEYMTQGSTVLSGRAPRKALAYGAHNSLALHISPLEGVSPLAHASTGPYSA
RDFYSATTYSSAPSPVPFAGYAPQQRDAAQWQQSSPFSGSPALTDHSVLADAGVAAPQPL
HPSQHVHVDEWAQLHTPPQAFEEHPAPVYEEHAQAYEQSYEDMVSSIEAEQNHAYDMFAA
DGVYSQASDGAYSQSSDSGYGAPALHPSAAVSDAEAYGVFDELQMAGY
Download sequence
Identical sequences S8EC84
jgi|Fompi3|1048193|gm1.3873_g jgi|Fompi1|99498|estExt_Genemark1.C_260117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]