SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi3|1048347|gm1.4027_g from Fomitopsis pinicola FP-58527 SS1 v3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Fompi3|1048347|gm1.4027_g
Domain Number - Region: 87-131
Classification Level Classification E-value
Superfamily HMG-box 0.000275
Family HMG-box 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi3|1048347|gm1.4027_g
Sequence length 147
Sequence
MVADADEREEIVQKALHELQTLPLRDLERFSTDTEKAMQVKKWFAKHSVEIRKARQGCKA
TTRGCDLWAREFKADILTTSHTVFVNEYPFDAYRKAMWKLWNALSEEKRKDWEKQGEAHR
AKVRGDLRGFVPPVLPQRSAALTLSSR
Download sequence
Identical sequences S8FK05
jgi|Fompi3|1048347|gm1.4027_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]