SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi3|1050640|gm1.6320_g from Fomitopsis pinicola FP-58527 SS1 v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fompi3|1050640|gm1.6320_g
Domain Number 1 Region: 116-165
Classification Level Classification E-value
Superfamily HMG-box 0.0000284
Family HMG-box 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi3|1050640|gm1.6320_g
Sequence length 235
Sequence
MTVVRDRLDRHCQRVQANTKTDRPMVTKSRGCLHGCVHVAHVVYAESSPTLGACLLFAGF
TQAAWIDRERFRGTAAEEGRKTRTTPRVQRRPSSSSGANGVRIVKRPTTRRRRLSSSSAK
HLIKAMSQPWKSQPAGERVQWEGLTKKKEHEVMYPNYVYRPQRTKERAKLKKATGRNGGA
QNADTESYISSVFPVASPPIVSPLGRHPASGRLHALMPHTTSPSPKIYPTLTMTI
Download sequence
Identical sequences S8E7N3
jgi|Fompi3|1050640|gm1.6320_g jgi|Fompi3|1050674|gm1.6354_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]