SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi3|1051703|gm1.7383_g from Fomitopsis pinicola FP-58527 SS1 v3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Fompi3|1051703|gm1.7383_g
Domain Number - Region: 121-157
Classification Level Classification E-value
Superfamily HMG-box 0.0613
Family HMG-box 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi3|1051703|gm1.7383_g
Sequence length 696
Sequence
MARTKPAKWNDTQSLAVLAYVQEYMAAPQDDREEVVEKVLSDLKRLPLEDLARFTSDTDK
AMQVSKWLQKHYAQLKEEMKGFKGTTRGCDLWAREEENKTAILQGVYQRHRGVSPLDAYC
SSMWKTWKALSKQDRAYWAAKATAVRAAVNGNLRDYEPPQLTVEALNAAMVRRVNAIQRK
LWVELGVCVSVLWAGHTVDRGFQFGIDDAMKLMFGQNISAHYMHAGKYFAEDTYIADFKE
CVMKWREWDDSDEDTSILLGGTNKQSKAQPRSNLGPLYEMDEATGLPILPPVQLLERLES
KNSHYWVALVRQFLNHHYKAASGGKVKAVPWKDFVGPGKDLSWLPEHMWDRAAVPFADPS
KVSKPNLITLVRTWSASNQDDLRLKGYQSADKHSILDTEYDTWLKRWEEDSELREAEKEL
ARERLEKKKAKSSGGANTSTPAVTPVSGDAVAASTSSSAQTPPIPPGVASLSTATQAKDA
PQAKAHPKPKAPQKPKAAPKTKAAPKANAVPTATQGVIAKATLAQPDSSPPNAALPSQHI
PGSQVASAPQVALSQVPSKQPAGKGKGRALALSEEPGEQEKPSERQGSGERGWPTYNAAD
YDEDMPSPLDLLTQASSGAGQGGGSSRRRGGLMPPAVNSSVNPAMIMAAPGNTGSALAET
RSALQPTTIAPRPTPINCIRENRPSSSRLLQQSSTL
Download sequence
Identical sequences S8E0M1
jgi|Fompi3|1051703|gm1.7383_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]