SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi3|1054032|gm1.9712_g from Fomitopsis pinicola FP-58527 SS1 v3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Fompi3|1054032|gm1.9712_g
Domain Number - Region: 261-316
Classification Level Classification E-value
Superfamily HMG-box 0.0109
Family HMG-box 0.0094
Further Details:      
 
Domain Number - Region: 434-448
Classification Level Classification E-value
Superfamily Ornithine decarboxylase C-terminal domain 0.0484
Family Ornithine decarboxylase C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi3|1054032|gm1.9712_g
Sequence length 556
Sequence
MKQEDNTDAQAKVDGPFYSVLGGPKAGRGIFTVQPGTTMGAYPYPLPVIVTCDTYEQARC
VLSLQPHFDIAGKALGPSHNIIKDIIISLLQPGVETVVPMSGHAYAVSKGRYTGVQLRWV
YCEMEVKPERVICSKYTSDILFCKRPTLPQAIVAYITKQGRGGKVENELSSTTVDMLCNL
YNEEFIASLEGLNLGTSPPKRKQEHNLAINEAVIKSQDVVWQDTIAMQAQFGGKKTVAYW
YRRILQQPTLNTMSRRRANRWNAYLRGELKSRNEDRAEGDKLRIDDIQDELRETWNTMSK
RQKEEATKDYMEELEEQRNIQRYAKHNTENAAFRDAQGNVAGVKITLGDLATRTDVHSLL
FTFHGSPEAWAKPSVFYTHESVPLFFNLFLRNTIASIATRLDSYIVSGAHEVIRNHKDRF
AQMKHELSVLVLQKLIVTYPPGVPFVAPSKLPTLHEAELVLASWESGTTHWRLMPKPEFD
QWKINNPDDDAPAPTHSDAPAPTNVPAPADAPAPADAPAPANVPAPADAPADVSKPPLKG
PASQPRALRTRLGRGV
Download sequence
Identical sequences S8F179
jgi|Fompi3|1054032|gm1.9712_g jgi|Fompi1|86475|gm1.4566_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]