SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi3|1056553|gm1.12233_g from Fomitopsis pinicola FP-58527 SS1 v3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Fompi3|1056553|gm1.12233_g
Domain Number - Region: 74-124
Classification Level Classification E-value
Superfamily HMG-box 0.00744
Family HMG-box 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi3|1056553|gm1.12233_g
Sequence length 197
Sequence
MSQEVEVTAGPGPGPVRDAAAQLRADKQENIEADLQAWYSYSTTVAAKMSDDYALSQSHI
LNLMFQAGAKVIHSRNPNVYNAWLHRRADEVNDGLPKGERMKLSEIQEQYGEEYYELTDE
QKFELMEGLMDDRDTNFKGARLTSRGRLKTLSSVMQNIEKQYAYLKLVCGIDAMSLIVRN
DPSFHFDPISSGKTPFT
Download sequence
Identical sequences S8DGY7
jgi|Fompi3|1056553|gm1.12233_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]