SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi3|111082|Fompi1.fgenesh1_pg.4_#_50 from Fomitopsis pinicola FP-58527 SS1 v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fompi3|111082|Fompi1.fgenesh1_pg.4_#_50
Domain Number 1 Region: 28-110
Classification Level Classification E-value
Superfamily HMG-box 2.49e-19
Family HMG-box 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi3|111082|Fompi1.fgenesh1_pg.4_#_50
Sequence length 508
Sequence
MQRQPYYRTQSHSSATSERRAQRNRARDPSWVPRPPNAFIIFRAEYSRKHAQANKDSSVK
TPEKTLSKRAAETWRVLSESEKARYKQLAEQERLDHAKKHPDYRYKPQRRQGDVPRVTVS
ISRREQVESFVRRRTAMRSKSRSSESESASDCTSPPSPASVDYSSSSPEPLNTPFRDNSP
ATCMWSEGRSSSLPSRLSAPLYHHSEHSLLLSGCSGASDFPQFSTDSFDDEKPGLYTDAS
SHYGDPFPWPIQPLDAGFNLWPSAQGAGLAHSPSASPVRSALSAFSFGSSDMSGVATPPD
LYPPATASNVASSVSVATSPLLQRRKAATTSGTFPSPLSVVSSSLAQWNNAPVPTVAITG
ASPTTERPPTPPTPPTPPMPPQAYVHPESRQPTDVRTWPPETFCSGPAQGGRVDYDRTPR
ASNFPATVHAEFLLRGTGGSPLDAVGDVYPWQGMRHFNIPAGTYYDVQADFQSYAMGLRE
MGIESYSTPHPPDVDINEFVNFDGDVAT
Download sequence
Identical sequences S8F9V9
jgi|Fompi3|111082|Fompi1.fgenesh1_pg.4_#_50 jgi|Fompi1|111082|fgenesh1_pg.4_#_50

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]