SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi3|114445|Fompi1.fgenesh1_pg.26_#_71 from Fomitopsis pinicola FP-58527 SS1 v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fompi3|114445|Fompi1.fgenesh1_pg.26_#_71
Domain Number 1 Region: 60-144
Classification Level Classification E-value
Superfamily HMG-box 1.7e-17
Family HMG-box 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi3|114445|Fompi1.fgenesh1_pg.26_#_71
Sequence length 488
Sequence
MPRAPSSKRARSAASAPTFDASGSAQFAFAPNVTPVSFNDPKPSLGPVSESSLFPSCDLP
PRKVTHSRKKPDDHIPRPPNAFILFRSSFVKSDHVSTTVESNHSTLSKIIGYTWGMLPPA
EKQIWFDKAKAMLEEHKAKYPGYSFRPESKPQTPYPTKKRKVREVGPKDTKRCEKIAELL
VKGKKGVELDQAVNEFDRSHIPEVVTRFDAPVTARHFRRSSSAPADERTSSPFLVLVPPA
NKLRAVSSQPDHSYPAYASSMPNTPGQYMPPLASEYDSTSSEYSAPSSPFADPYEYATSA
PNPEMGFDSFSFDTCAAPSPIETCDPLSSPYAEQQPDIFAPQPHLAYEMQQLAFHPSNGL
RIDTTVADGWASGPSSTPMSSSPNTPSPYPSEYMASHLQPTYYDGEMPQQLDELQGLPVD
MFQSNCVQQQWAQPTEEFYYPPMYATPAQIVTAEQDPVYQRYADISDPVYPQVQSYVPVA
HSYPIHSQ
Download sequence
Identical sequences S8EC16
jgi|Fompi1|114445|fgenesh1_pg.26_#_71 jgi|Fompi3|114445|Fompi1.fgenesh1_pg.26_#_71

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]