SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi3|140591|Fompi1.estExt_Genewise1Plus.C_220306 from Fomitopsis pinicola FP-58527 SS1 v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fompi3|140591|Fompi1.estExt_Genewise1Plus.C_220306
Domain Number 1 Region: 13-93
Classification Level Classification E-value
Superfamily HMG-box 4.58e-17
Family HMG-box 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi3|140591|Fompi1.estExt_Genewise1Plus.C_220306
Sequence length 147
Sequence
MTGPTRTDGAMRPGPTGSKPPRPPNAWILYRIDKLRELAERRDPTAPKRLQPEISKEISE
LWKAEDPEVKREYERIADIKKQEHQMQYPNYKFQPIKKEDRVRQREEEKAEKARVKEELR
KARGLQVPNLQNFSLASSSRRIAPYIP
Download sequence
Identical sequences S8ECA1
jgi|Fompi3|140591|Fompi1.estExt_Genewise1Plus.C_220306 jgi|Fompi1|140591|estExt_Genewise1Plus.C_220306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]