SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi3|1025562|fgenesh1_kg.75_#_14_#_isotig02198 from Fomitopsis pinicola FP-58527 SS1 v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fompi3|1025562|fgenesh1_kg.75_#_14_#_isotig02198
Domain Number 1 Region: 214-303
Classification Level Classification E-value
Superfamily HMG-box 7.72e-19
Family HMG-box 0.0008
Further Details:      
 
Domain Number 2 Region: 121-211
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000000017
Family HMG-box 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi3|1025562|fgenesh1_kg.75_#_14_#_isotig02198
Sequence length 358
Sequence
MPSGAMQLWDSPAAQPAVLTHPAVPFPSLSEDAYATQRQRVNSRRGLTPVTQLFQSSSAP
SISHARPPPLSRGYSRRAESISEHDDATIRIQKKKRAGSEEESLGAVPKRAETPPLKSTL
RPPKLAPSAWQLYFTDWIARHQASSSKKLNVAQAAKEAGQEYAKLSDAEKEPYKRRSQEA
KEMRERELAAYMKTLTPEDIKRENVFRTAQRRAGKSRKGNIKDPNAPKKPLSAYFMFLQR
IRSDPELVKEVFGDETETTKQSVLAAGKWRSMTDEERKPFLAQAEQEKLEYESARKMYEE
GTTGYGTSINFSILPSSPINSMPFPRSARQPKQEPVSSESESDGFTTDDGPDLPRRRS
Download sequence
Identical sequences S8DRV6
jgi|Fompi3|1025562|fgenesh1_kg.75_#_14_#_isotig02198 jgi|Fompi1|159756|estExt_fgenesh1_kg.C_100062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]