SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi3|1050800|gm1.6480_g from Fomitopsis pinicola FP-58527 SS1 v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fompi3|1050800|gm1.6480_g
Domain Number 1 Region: 69-208
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.00000000000371
Family DJ-1/PfpI 0.059
Further Details:      
 
Domain Number 2 Region: 514-624
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000222
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi3|1050800|gm1.6480_g
Sequence length 678
Sequence
MMEILKAFYGMPREEEEKEEGQLNSRGLWLLRVLSSESPASWRLDLHERYSLLGDVARGV
SVNTSPDALLPLDRLRIRQESTYVTVQDESRDALSHLNIGQANILSVTSFLSGARIESYD
LLFVPGTRDAAHVAPEVAGDAIRRIFHDRMNAIATGNARIALAASGLLRDRVASSDCLQL
TDTYIERARAWDVETRIVRDGGLWTANDDPETLTTLAILYKASRHYTIGGVFPLSVWDKY
FGGSDDEPHRLPPTSSVPASRTSGDDLAAELGGLSLSDDSQEIADLIFHFAIRLALEGYV
DQCNSLLTSLFIISPNAMENLGAPCMRPIEFVWESFDARPAVPWNSPSREDLDQWDREYR
NIHHLPPDEDREDILESIKLRISMSDDWLLTPYTLSGAVVMALDAGWNDQAREWILKLVQ
DAYEIDSNHVWASRIARWRPLAHFCKAGIVAEVTGRTPEQADHDAEAVKRAINSLRSSST
TSRTEQRESSVPRFADLAWDVLVPMLNVLKWEQHETLLKPPASSAAIRDAEERLGITLPE
DYKQFLLVSNGIEFMPSIDAPGFRAIEALKWETAEELGLDEFRVDLGCKTDPGEYERLPK
MARVLVISDDSEETVWFVDPATAREAIHVLRDEGRSDDVTGQPGWRAVFWANYLTELEWL
PSFRGYMERLAEKAEKAK
Download sequence
Identical sequences S8E3E7
jgi|Fompi1|89198|gm1.7289_g jgi|Fompi3|1050800|gm1.6480_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]