SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi3|110679|Fompi1.fgenesh1_pg.2_#_288 from Fomitopsis pinicola FP-58527 SS1 v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fompi3|110679|Fompi1.fgenesh1_pg.2_#_288
Domain Number 1 Region: 376-461,498-510
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000413
Family UBX domain 0.036
Further Details:      
 
Domain Number 2 Region: 183-274
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000159
Family Thioltransferase 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi3|110679|Fompi1.fgenesh1_pg.2_#_288
Sequence length 566
Sequence
MIFENGIPTTAPRSPSPRPSAHMEEFDIDDSAQGLLGSPRGGREFQRVRPSTAGALSIRP
LRAVLAILALPLRLLTSVLRFIFRILRIPFPQFVPFTWSNLQYRPLGPRSGAEGRALDPR
AQAERWVRALEEETGAVCVGRARARRAEAGSGSVASGADAAGPSGLTSRAAMYGEEDGVT
KLLPDFFLGSYEEFVRMCERNAKIGCVVLVSEEHDDVPEFKRSTLTDPTLLKLIQENEIM
VWGGDIRDREAWSAAQKLQATTYPCVAFIALQQRRLGGSGSSTSPVLTVLSRHQGPSIPS
TSAPTAPQTLSTHLTEQLLPRVTPFLGKLRAQAAEREHERQLRAEQDRAFEESRRRDRER
IEARQSEERRRAAAEARAQEDALAQEEARRAWEAHRMAWRRYLRRGLVVREPRPGETGRG
KTVRVGLRMPDGRRAVRFFGESDTLSALYAYVDSMFIPKELPESADPAAPPADGALGEAG
LVQGIESSGRAPEKWWGFKLWLAYPRKEVVWEPAKRLGDVEALKGGGQLVVESAADEESA
KAKGKQRATDVTASAEDEDDGYETED
Download sequence
Identical sequences S8FFG2
jgi|Fompi3|110679|Fompi1.fgenesh1_pg.2_#_288 jgi|Fompi1|110679|fgenesh1_pg.2_#_288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]