SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|212224048|ref|YP_002307284.1| from Thermococcus onnurineus NA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212224048|ref|YP_002307284.1|
Domain Number 1 Region: 85-211
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 7.59e-34
Family AlaX-like 0.000000545
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily Translation proteins 1.45e-21
Family AlaX-M N-terminal domain-like 0.0000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|212224048|ref|YP_002307284.1|
Sequence length 214
Comment alanyl-tRNA synthetase [Thermococcus onnurineus NA1]
Sequence
MTRKLYYEDAYLKEAKAKVLEIREGALLLDQTIFYPTGGGQPHDRGTINGVEVLDVYKDD
AGNVWHAVAEPGKFKPGDEVELKIDWDYRYKLMRIHSAMHLLEHVLNEVLGEGNWELYGS
GMSAEKGRYDILYPENVNQYKEKIIELFNKYVDEGGEMKIWWEGETRYTQIRDFEVIPCG
GTHVKDIKEIGHLKKLKRSSLGKGKQRLEIWLED
Download sequence
Identical sequences B6YWC4
523850.TON_0899 gi|212224048|ref|YP_002307284.1| WP_012571859.1.24713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]