SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|212224582|ref|YP_002307818.1| from Thermococcus onnurineus NA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212224582|ref|YP_002307818.1|
Domain Number 1 Region: 4-148
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.01e-35
Family AlaX-like 0.00000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|212224582|ref|YP_002307818.1|
Sequence length 151
Comment alanyl-tRNA synthetase [Thermococcus onnurineus NA1]
Sequence
MEPVEVRAHTALHVVKGAVVKVLGEGAKWTASVYVGGNHGRLTVKFDRKLTPEEVAEIER
LANKKVKENVPIHIYELPRNEAEKRFGEDMYDLFPILPEVKTLKVAVIEDWNVNACKEEH
TATTGEIGRIKIRKVRFRKSKELLEISFDVL
Download sequence
Identical sequences B6YXV8
gi|212224582|ref|YP_002307818.1| 523850.TON_1431 WP_012572393.1.24713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]