SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|212224880|ref|YP_002308116.1| from Thermococcus onnurineus NA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212224880|ref|YP_002308116.1|
Domain Number 1 Region: 57-264
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.48e-58
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00011
Further Details:      
 
Domain Number 2 Region: 308-501
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 6.02e-50
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0001
Further Details:      
 
Domain Number 3 Region: 599-748
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 8.37e-48
Family AlaX-like 0.0007
Further Details:      
 
Domain Number 4 Region: 512-595
Classification Level Classification E-value
Superfamily Translation proteins 5.65e-20
Family AlaX-M N-terminal domain-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|212224880|ref|YP_002308116.1|
Sequence length 909
Comment alanyl-tRNA synthetase [Thermococcus onnurineus NA1]
Sequence
MSMDMTTRMFKEEGWMRKQCPKCGKFFWTLDPERKTCGDPPCDEYGFIGKPGIPKKYTLD
EMREKFLSFFEKHGHGRVKRYPVLPRWRDDVLLVGASIMDFQPWVISGEADPPANPLTIS
QPSIRFTDIDNVGITGRHFTIFEMMAHHAFNYPGKPIYWMDETVELAFEFFTKELGMKAE
DITFKENPWAGGGNAGPAFEVLYRGLEVATLVFMQYKKAPENADPSQVVEIKGDKYVPME
TMVVDTGYGLERLVWMSQGTPTAYDAVLGYVIEPLKRMAGIEKIDERILMENSKLAGMFD
IEDMGDLRVLRQEVAKRVGISVEELEKLVRPYELIYAIADHTKALTFMLADGVIPSNVKA
GYLARLLIRKSIRHLRELGLEMPLAEIVAMHIKELSPSFPEFKEMEDVILDIINVEEKRY
QETLRRGSDLVKREIAKLKKKGENEIPLEKLILFYESHGLTPEIVAEIAQKEGVKVHIPD
NFYTLVAKEAEKEEKKEAAQYVVDFELVKDLPDTRTLYYEDPFMKEFDAEVLRVIDDWVV
LDRTAFYPEGGGQPYDTGELNGVKVTNVQKVGKVILHRVEEPEKFKEGMTVHGRINWDRR
IQHMRHHTGTHVLMGALVRVLGKHVWQAGSQLHTDWARLDISHYKRITEEELREIERLAN
RIVMENRRVAWEWLPRTEAEMKYGFRLYQGGVVPGRIIRVLRIEDWDVQACGGTHLPNTG
LVGPIKILRTERIQDGVERIIFAAGEAAVNWMQETERILKRTSEVFRVPPEKLPETAGRF
FNEWKEARKEVERLRKELAKLLVYELEDRIERVGEVEFIGAVVEGTMDDLREAANKLRKD
KRVVLLISREGHFVVAVGDGLDLKAGELAKVITSVAGGGGGGRKELAQGRIKNPLKAEEA
IAEVKKRLG
Download sequence
Identical sequences B6YUZ1
WP_012572691.1.24713 gi|212224880|ref|YP_002308116.1| 523850.TON_1729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]