SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|212224908|ref|YP_002308144.1| from Thermococcus onnurineus NA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212224908|ref|YP_002308144.1|
Domain Number 1 Region: 92-235
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.96e-35
Family AlaX-like 0.01
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000000494
Family AlaX-M N-terminal domain-like 0.0016
Further Details:      
 
Weak hits

Sequence:  gi|212224908|ref|YP_002308144.1|
Domain Number - Region: 259-291
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0314
Family Mitotic arrest deficient-like 1, Mad1 0.0092
Further Details:      
 
Domain Number - Region: 368-403
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.0733
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|212224908|ref|YP_002308144.1|
Sequence length 404
Comment hypothetical protein TON_1757 [Thermococcus onnurineus NA1]
Sequence
MTERLFYLYPYLKGSEAVVQAVEQGNGVIRLALDRTIFYPEGGGQPSDRGVIEGNGFRVL
VDRVYERDRIWHEGKLEGRLPEAGERVRLVLDWDWRYENMKNHTGQHILSAVLKNLYGLD
TTGFQIFDDYNKIEVNGELDWEMITRAEIEANSIVWEAIPVTVEEFKDLPDDIARTLRKH
VSKVTDRVRIVMIGDIDRTPCGGTHVRNTSEIGLIKVLRFYRKSKKLWRIEFVAGNRALK
YLNKLLADYWESLDEMPNKNRPLVERVKDLKAELDKLEEEKDNLRKELWEWKAKALLDRA
EEIGGVRIVSHIESADMKDAQAFVVYLVDKNPGTIALVVGKNYVIFAKNRDVEGISMNEL
LKEVLAKVGGGGGGGEMLARGGGFKLPPEDVLRTALNILKTYLS
Download sequence
Identical sequences B6YV19
523850.TON_1757 WP_012572719.1.24713 gi|212224908|ref|YP_002308144.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]